Products

cDNA Clones (7)
Proteins (3)
Antibodies (2)
Jump to Filters
View as table Download
PAPOLB (NM_020144) Human Tagged ORF Clone
RC205991

USD 420.00

In Stock

PAPOLB (Myc-DDK-tagged)-Human poly(A) polymerase beta (testis specific) (PAPOLB)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PAPOLB (NM_020144) Human Tagged ORF Clone
RC205991L3

USD 620.00

3 Weeks

Lenti-ORF clone of PAPOLB (Myc-DDK-tagged)-Human poly(A) polymerase beta (testis specific) (PAPOLB)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PAPOLB (NM_020144) Human Tagged ORF Clone Lentiviral Particle
RC205991L3V

USD 820.00

6 Weeks

Lenti ORF particles, PAPOLB (Myc-DDK-tagged)-Human poly(A) polymerase beta (testis specific) (PAPOLB), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PAPOLB (NM_020144) Human Tagged ORF Clone
RC205991L4

USD 620.00

3 Weeks

Lenti-ORF clone of PAPOLB (mGFP-tagged)-Human poly(A) polymerase beta (testis specific) (PAPOLB)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PAPOLB (NM_020144) Human Tagged ORF Clone Lentiviral Particle
RC205991L4V

USD 820.00

6 Weeks

Lenti ORF particles, PAPOLB (mGFP-tagged)-Human poly(A) polymerase beta (testis specific) (PAPOLB), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PAPOLB (NM_020144) Human Tagged ORF Clone
RG205991

USD 460.00

3 Weeks

PAPOLB (GFP-tagged) - Human poly(A) polymerase beta (testis specific) (PAPOLB)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PAPOLB Rabbit Polyclonal Antibody
TA343891

USD 475.00

5 Days

Rabbit Polyclonal Anti-PAPOLB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PAPOLB antibody: synthetic peptide directed towards the N terminal of human PAPOLB. Synthetic peptide located within the following region: TDCLLTQRLIETLRPFGVFEEEEELQRRILVLEKLNNLVKEWIREISESK
PAPOLB Rabbit Polyclonal Antibody
TA343892

USD 475.00

5 Days

Rabbit Polyclonal Anti-PAPOLB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PAPOLB antibody: synthetic peptide directed towards the middle region of human PAPOLB. Synthetic peptide located within the following region: MEEFRTMWVIGLGLKKPDNSEILSIDLTYDIQSFTDTVYRQAVNSKMFEM
PAPOLB (NM_020144) Human Untagged Clone
SC304710

USD 760.00

3 Weeks

PAPOLB (untagged)-Human poly(A) polymerase beta (testis specific) (PAPOLB)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
PAPOLB (NM_020144) ICC Control Block
TB405991

USD 1,070.00

4 Weeks

Transient overexpression of PAPOLB (NM_020144) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PAPOLB Cytosection
TS405991

USD 225.00

4 Weeks

Transient overexpression of PAPOLB (NM_020144) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

PAPOLB Cytosection
TS405991P5

USD 889.00

4 Weeks

Transient overexpression of PAPOLB (NM_020144) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack