RDH11 (Myc-DDK-tagged)-Human retinol dehydrogenase 11 (all-trans/9-cis/11-cis) (RDH11)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
RDH11 (Myc-DDK-tagged)-Human retinol dehydrogenase 11 (all-trans/9-cis/11-cis) (RDH11)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human retinol dehydrogenase 11 (all-trans/9-cis/11-cis) (RDH11)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, RDH11 (Myc-DDK tagged) - Human retinol dehydrogenase 11 (all-trans/9-cis/11-cis) (RDH11), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, RDH11 (mGFP-tagged) - Human retinol dehydrogenase 11 (all-trans/9-cis/11-cis) (RDH11), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
RDH11 (GFP-tagged) - Human retinol dehydrogenase 11 (all-trans/9-cis/11-cis) (RDH11)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human retinol dehydrogenase 11 (all-trans/9-cis/11-cis) (RDH11), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, RDH11 (Myc-DDK tagged) - Human retinol dehydrogenase 11 (all-trans/9-cis/11-cis) (RDH11), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human retinol dehydrogenase 11 (all-trans/9-cis/11-cis) (RDH11), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, RDH11 (mGFP-tagged) - Human retinol dehydrogenase 11 (all-trans/9-cis/11-cis) (RDH11), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
RDH11 (myc-DDK-tagged) - Human retinol dehydrogenase 11 (all-trans/9-cis/11-cis) (RDH11), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
RDH11 MS Standard C13 and N15-labeled recombinant protein (NP_057110)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Rabbit Polyclonal Anti-RDH11 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RDH11 antibody: synthetic peptide directed towards the C terminal of human RDH11. Synthetic peptide located within the following region: SFFIKTPQQGAQTSLHCALTEGLEILSGNHFSDCHVAWVSAQARNETIAR |
Lenti ORF clone of Human retinol dehydrogenase 11 (all-trans/9-cis/11-cis) (RDH11), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human retinol dehydrogenase 11 (all-trans/9-cis/11-cis) (RDH11), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
RDH11 (untagged)-Human retinol dehydrogenase 11 (all-trans/9-cis/11-cis) (RDH11)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
RDH11 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
RDH11 (untagged)-Human retinol dehydrogenase 11 (all-trans/9-cis/11-cis) (RDH11)
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Carrier-free (BSA/glycerol-free) RDH11 mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Transient overexpression lysate of retinol dehydrogenase 11 (all-trans/9-cis/11-cis) (RDH11)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
RDH11 (GFP-tagged) - Human retinol dehydrogenase 11 (all-trans/9-cis/11-cis) (RDH11), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
RDH11 (untagged) - Human retinol dehydrogenase 11 (all-trans/9-cis/11-cis) (RDH11), transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-RDH11 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human RDH11 |
Anti-RDH11 mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
Anti-RDH11 mouse monoclonal antibody, clone OTI1B4 (formerly 1B4), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Biotin |
Anti-RDH11 mouse monoclonal antibody, clone OTI1B4 (formerly 1B4), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | HRP |
Anti-RDH11 mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Transient overexpression of RDH11 (NM_016026) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of RDH11 (NM_001252650) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of RDH11 (NM_016026) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of RDH11 (NM_016026) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of RDH11 (NM_001252650) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack