Products

View as table Download

RDH11 (Myc-DDK-tagged)-Human retinol dehydrogenase 11 (all-trans/9-cis/11-cis) (RDH11)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, RDH11 (Myc-DDK tagged) - Human retinol dehydrogenase 11 (all-trans/9-cis/11-cis) (RDH11), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, RDH11 (mGFP-tagged) - Human retinol dehydrogenase 11 (all-trans/9-cis/11-cis) (RDH11), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

RDH11 (GFP-tagged) - Human retinol dehydrogenase 11 (all-trans/9-cis/11-cis) (RDH11)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human retinol dehydrogenase 11 (all-trans/9-cis/11-cis) (RDH11), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, RDH11 (Myc-DDK tagged) - Human retinol dehydrogenase 11 (all-trans/9-cis/11-cis) (RDH11), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human retinol dehydrogenase 11 (all-trans/9-cis/11-cis) (RDH11), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, RDH11 (mGFP-tagged) - Human retinol dehydrogenase 11 (all-trans/9-cis/11-cis) (RDH11), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

RDH11 (myc-DDK-tagged) - Human retinol dehydrogenase 11 (all-trans/9-cis/11-cis) (RDH11), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

RDH11 MS Standard C13 and N15-labeled recombinant protein (NP_057110)

Tag C-Myc/DDK
Expression Host HEK293

Rabbit Polyclonal Anti-RDH11 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RDH11 antibody: synthetic peptide directed towards the C terminal of human RDH11. Synthetic peptide located within the following region: SFFIKTPQQGAQTSLHCALTEGLEILSGNHFSDCHVAWVSAQARNETIAR

Lenti ORF clone of Human retinol dehydrogenase 11 (all-trans/9-cis/11-cis) (RDH11), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human retinol dehydrogenase 11 (all-trans/9-cis/11-cis) (RDH11), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

RDH11 (untagged)-Human retinol dehydrogenase 11 (all-trans/9-cis/11-cis) (RDH11)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

RDH11 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

RDH11 (untagged)-Human retinol dehydrogenase 11 (all-trans/9-cis/11-cis) (RDH11)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

Carrier-free (BSA/glycerol-free) RDH11 mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Transient overexpression lysate of retinol dehydrogenase 11 (all-trans/9-cis/11-cis) (RDH11)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

RDH11 (GFP-tagged) - Human retinol dehydrogenase 11 (all-trans/9-cis/11-cis) (RDH11), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

RDH11 (untagged) - Human retinol dehydrogenase 11 (all-trans/9-cis/11-cis) (RDH11), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

Rabbit Polyclonal Anti-RDH11 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human RDH11

Anti-RDH11 mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Anti-RDH11 mouse monoclonal antibody, clone OTI1B4 (formerly 1B4), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Biotin

Anti-RDH11 mouse monoclonal antibody, clone OTI1B4 (formerly 1B4), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation HRP

Anti-RDH11 mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Transient overexpression of RDH11 (NM_016026) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of RDH11 (NM_001252650) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of RDH11 (NM_016026) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of RDH11 (NM_016026) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of RDH11 (NM_001252650) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack