Products

View as table Download

UGT1A9 (Myc-DDK-tagged)-Human UDP glucuronosyltransferase 1 family, polypeptide A9 (UGT1A9)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, UGT1A9 (mGFP-tagged) - Human UDP glucuronosyltransferase 1 family, polypeptide A9 (UGT1A9), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

UGT1A9 (GFP-tagged) - Human UDP glucuronosyltransferase 1 family, polypeptide A9 (UGT1A9)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human UDP glucuronosyltransferase 1 family, polypeptide A9 (UGT1A9), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, UGT1A9 (Myc-DDK tagged) - Human UDP glucuronosyltransferase 1 family, polypeptide A9 (UGT1A9), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human UDP glucuronosyltransferase 1 family, polypeptide A9 (UGT1A9), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, UGT1A9 (mGFP-tagged) - Human UDP glucuronosyltransferase 1 family, polypeptide A9 (UGT1A9), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

UGT1A9 (untagged)-Human UDP glucuronosyltransferase 1 family, polypeptide A9 (UGT1A9)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

Lenti ORF clone of Human UDP glucuronosyltransferase 1 family, polypeptide A9 (UGT1A9), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Rabbit Polyclonal antibody to UGT1A9 (UDP glucuronosyltransferase 1 family, polypeptide A9)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 291 and 530 of UGT1A9 (Uniprot ID#O60656)

UGT1A9 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human UGT1A9

Lenti ORF clone of Human UDP glucuronosyltransferase 1 family, polypeptide A9 (UGT1A9), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

UGT1A9 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Purified recombinant protein of Human UDP glucuronosyltransferase 1 family, polypeptide A9 (UGT1A9), full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug

Tag N-GST and C-His
Expression Host E. coli

Rabbit Polyclonal anti-UGT1A9 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UGT1A9 antibody: synthetic peptide directed towards the N terminal of human UGT1A9. Synthetic peptide located within the following region: LLMGSYNDIFDLFFSNCRSLFKDKKLVEYLKESSFDAVFLDPFDNCGLIV

Transient overexpression of UGT1A9 (NM_021027) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of UGT1A9 (NM_021027) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of UGT1A9 (NM_021027) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack