Products

View as table Download

Rabbit Polyclonal Anti-RPSA Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human RPSA

Rabbit Polyclonal RPSA Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen RPSA antibody was raised against a 17 amino acid peptide near the carboxy terminus of human RPSA.

Rabbit Polyclonal Anti-RPSA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RPSA antibody: synthetic peptide directed towards the middle region of human RPSA. Synthetic peptide located within the following region: TFTNQIQAAFREPRLLVVTDPRADHQPLTEASYVNLPTIALCNTDSPLRY

Carrier-free (BSA/glycerol-free) RPSA mouse monoclonal antibody,clone OTI1G3

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated