Germany
Japan
United Kingdom
China
RPL11 (Myc-DDK-tagged)-Human ribosomal protein L11 (RPL11), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, RPL11 (Myc-DDK tagged) - Human ribosomal protein L11 (RPL11), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, RPL11 (mGFP-tagged) - Human ribosomal protein L11 (RPL11), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Recombinant protein of human ribosomal protein L11 (RPL11)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
RPL11 (GFP-tagged) - Human ribosomal protein L11 (RPL11), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human ribosomal protein L11 (RPL11), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, RPL11 (Myc-DDK tagged) - Human ribosomal protein L11 (RPL11), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human ribosomal protein L11 (RPL11), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, RPL11 (mGFP-tagged) - Human ribosomal protein L11 (RPL11), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
RPL11 (Myc-DDK tagged) - Homo sapiens ribosomal protein L11 (RPL11), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
RPL11 (GFP-tagged) - Homo sapiens ribosomal protein L11 (RPL11), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human ribosomal protein L11 (RPL11), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Transient overexpression lysate of ribosomal protein L11 (RPL11)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human ribosomal protein L11 (RPL11), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
RPL11 (untagged)-Human ribosomal protein L11 (RPL11), transcript variant 1
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
RPL11 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-RPL11 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RPL11 antibody is: synthetic peptide directed towards the C-terminal region of Human RPL11. Synthetic peptide located within the following region: DFYVVLGRPGFSIADKKRRTGCIGAKHRISKEEAMRWFQQKYDGIILPGK |
RPL11 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human RPL11 |
RPL11 (1-178, His-tag) human protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
RPL11 (1-178, His-tag) human protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
RPL11 MS Standard C13 and N15-labeled recombinant protein (NP_000966)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
RPL11 (untagged) - Homo sapiens ribosomal protein L11 (RPL11), transcript variant 2
| Vector | pCMV6 series |
| Tag | Tag Free |
Rabbit Polyclonal Anti-RPL11 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human RPL11 |
Transient overexpression of RPL11 (NM_000975) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of RPL11 (NM_001199802) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of RPL11 (NM_000975) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of RPL11 (NM_000975) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of RPL11 (NM_001199802) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- RPL11
Pathways
- Ribosome