Products

cDNA Clones (11)
Proteins (8)
Antibodies (2)
Jump to Filters
View as table Download
RPL18A (NM_000980) Human Tagged ORF Clone
RC209771

USD 98.00

USD 390.00

In Stock

RPL18A (Myc-DDK-tagged)-Human ribosomal protein L18a (RPL18A)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
RPL18A (NM_000980) Human Tagged ORF Clone
RG209771

USD 460.00

In Stock

RPL18A (GFP-tagged) - Human ribosomal protein L18a (RPL18A)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
RPL18A (NM_000980) Human Tagged ORF Clone
RC209771L3

USD 620.00

3 Weeks

Lenti ORF clone of Human ribosomal protein L18a (RPL18A), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RPL18A (NM_000980) Human Tagged ORF Clone
RC209771L4

USD 620.00

3 Weeks

Lenti ORF clone of Human ribosomal protein L18a (RPL18A), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RPL18A (NM_000980) Human Tagged ORF Clone
RC209771L1

USD 620.00

In Stock

Lenti ORF clone of Human ribosomal protein L18a (RPL18A), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
RPL18A (C-term) Rabbit Polyclonal Antibody
AP53710PU-N

USD 450.00

2 Weeks

RPL18A (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of Human RPL18A.
RPL18A (NM_000980) Human Tagged ORF Clone
RC209771L2

USD 620.00

3 Weeks

Lenti ORF clone of Human ribosomal protein L18a (RPL18A), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
RPL18A (NM_000980) Human Untagged Clone
SC119487

USD 310.00

In Stock

RPL18A (untagged)-Human ribosomal protein L18a (RPL18A)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
RPL18A Rabbit Polyclonal Antibody
TA334363

USD 375.00

5 Days

Rabbit Polyclonal Anti-RPL18A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RPL18A antibody is: synthetic peptide directed towards the C-terminal region of Human RPL18A. Synthetic peptide located within the following region: IMKVEEIAASKCRRPAVKQFHDSKIKFPLPHRVLRRQHKPRFTTKRPNTF
RPL18A (NM_000980) Human Recombinant Protein
TP761799

USD 215.00

In Stock

Purified recombinant protein of Human ribosomal protein L18a (RPL18A), full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug

Tag N-GST and C-His
Expression Host E. coli
RPL18A (NM_000980) Human Over-expression Lysate
LY424426

USD 396.00

5 Days

Transient overexpression lysate of ribosomal protein L18a (RPL18A)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
RPL18A (1-176, His-tag) Human Protein
AR51490PU-N

USD 1,105.00

2 Weeks

RPL18A (1-176, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
RPL18A (1-176, His-tag) Human Protein
AR51490PU-S

USD 415.00

2 Weeks

RPL18A (1-176, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
RPL18A (NM_000980) Human Over-expression Lysate
LC424426

USD 121.00

2 Weeks

RPL18A HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
RPL18A ICC Control Block
TB409771

USD 1,040.00

4 Weeks

Transient overexpression of RPL18A (NM_000980) in HEK293T cells paraffin embedded controls for ICC/IHC staining

RPL18A Cytosection
TS409771

USD 225.00

4 Weeks

Transient overexpression of RPL18A (NM_000980) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

RPL18A Cytosection
TS409771P5

USD 889.00

4 Weeks

Transient overexpression of RPL18A (NM_000980) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack