RPL18A (Myc-DDK-tagged)-Human ribosomal protein L18a (RPL18A)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
RPL18A (Myc-DDK-tagged)-Human ribosomal protein L18a (RPL18A)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, RPL18A (Myc-DDK tagged) - Human ribosomal protein L18a (RPL18A), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, RPL18A (mGFP-tagged) - Human ribosomal protein L18a (RPL18A), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
RPL18A (GFP-tagged) - Human ribosomal protein L18a (RPL18A)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human ribosomal protein L18a (RPL18A), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, RPL18A (Myc-DDK tagged) - Human ribosomal protein L18a (RPL18A), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human ribosomal protein L18a (RPL18A), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, RPL18A (mGFP-tagged) - Human ribosomal protein L18a (RPL18A), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human ribosomal protein L18a (RPL18A), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
RPL18A (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of Human RPL18A. |
Lenti ORF clone of Human ribosomal protein L18a (RPL18A), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
RPL18A (untagged)-Human ribosomal protein L18a (RPL18A)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-RPL18A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RPL18A antibody is: synthetic peptide directed towards the C-terminal region of Human RPL18A. Synthetic peptide located within the following region: IMKVEEIAASKCRRPAVKQFHDSKIKFPLPHRVLRRQHKPRFTTKRPNTF |
Purified recombinant protein of Human ribosomal protein L18a (RPL18A), full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug
Tag | N-GST and C-His |
Expression Host | E. coli |
Transient overexpression lysate of ribosomal protein L18a (RPL18A)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
RPL18A (1-176, His-tag) human recombinant protein, 0.5 mg
Tag | His-tag |
Expression Host | E. coli |
RPL18A (1-176, His-tag) human recombinant protein, 0.1 mg
Tag | His-tag |
Expression Host | E. coli |
RPL18A HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression of RPL18A (NM_000980) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of RPL18A (NM_000980) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of RPL18A (NM_000980) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack