Products

View as table Download

RPL3 (Myc-DDK-tagged)-Human ribosomal protein L3 (RPL3), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

RPL3 (Myc-DDK-tagged)-Human ribosomal protein L3 (RPL3), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

RPL3 (GFP-tagged) - Human ribosomal protein L3 (RPL3), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human ribosomal protein L3 (RPL3), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, RPL3 (Myc-DDK tagged) - Human ribosomal protein L3 (RPL3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human ribosomal protein L3 (RPL3), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, RPL3 (mGFP-tagged) - Human ribosomal protein L3 (RPL3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human ribosomal protein L3 (RPL3), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, RPL3 (Myc-DDK tagged) - Human ribosomal protein L3 (RPL3), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human ribosomal protein L3 (RPL3), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, RPL3 (mGFP-tagged) - Human ribosomal protein L3 (RPL3), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

RPL3 (GFP-tagged) - Human ribosomal protein L3 (RPL3), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Rabbit polyclonal anti-RPL3 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RPL3.

Rabbit Polyclonal Anti-RPL3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RPL3 antibody: synthetic peptide directed towards the N terminal of human RPL3. Synthetic peptide located within the following region: DPSKPVHLTAFLGYKAGMTHIVREVDRPGSKVNKKEVVEAVTIVETPPMV

Rabbit Polyclonal Anti-RPL3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RPL3 antibody: synthetic peptide directed towards the C terminal of human RPL3. Synthetic peptide located within the following region: YHHRTEINKKIYKIGQGYLIKDGKLIKNNASTDYDLSDKSINPLGGFVHY

Transient overexpression lysate of ribosomal protein L3 (RPL3), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

RPL3 (untagged)-Human ribosomal protein L3 (RPL3), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

RPL3 (untagged)-Human ribosomal protein L3 (RPL3), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

RPL3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Purified recombinant protein of Human ribosomal protein L3 (RPL3), transcript variant 1, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug

Tag N-GST and C-His
Expression Host E. coli

RPL3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

RPL3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of ribosomal protein L3 (RPL3), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LY422420 is the same product as LY425582.

Transient overexpression lysate of ribosomal protein L3 (RPL3), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

(untagged)-Human mRNA, cDNA DKFZp686B0827 (from clone DKFZp686B0827)

Vector pCMV6 series
Tag Tag Free

USD 1,070.00

4 Weeks

Transient overexpression of RPL3 (NM_000967) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 1,070.00

4 Weeks

Transient overexpression of RPL3 (NM_001033853) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of RPL3 (NM_000967) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of RPL3 (NM_000967) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

USD 225.00

4 Weeks

Transient overexpression of RPL3 (NM_001033853) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of RPL3 (NM_001033853) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack