Products

cDNA Clones (44)
Proteins (13)
RNAi (12)
Gene Expression (8)
Antibodies (7)
Jump to Filters
View as table Download
RPL3 (NM_001033853) Human Tagged ORF Clone
RC217987

USD 420.00

In Stock

RPL3 (Myc-DDK-tagged)-Human ribosomal protein L3 (RPL3), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
RPL3 (NM_000967) Human Tagged ORF Clone
RC203343

USD 420.00

In Stock

RPL3 (Myc-DDK-tagged)-Human ribosomal protein L3 (RPL3), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Rpl3 (NM_013762) Mouse Tagged ORF Clone
MR206317

USD 300.00

In Stock

Rpl3 (Myc-DDK-tagged) - Mouse ribosomal protein L3 (Rpl3)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
RPL3 (NM_000967) Human Tagged ORF Clone
RG203343

USD 460.00

In Stock

RPL3 (GFP-tagged) - Human ribosomal protein L3 (RPL3), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Rpl3 (BC094059) Mouse Tagged ORF Clone
MR206324

USD 240.00

In Stock

Rpl3 (Myc-DDK-tagged) - Mouse ribosomal protein L3 (cDNA clone MGC:102482 IMAGE:3676103)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Rpl3 (BC083134) Mouse Tagged ORF Clone
MR206326

USD 240.00

In Stock

Rpl3 (Myc-DDK-tagged) - Mouse ribosomal protein L3 (cDNA clone MGC:103388 IMAGE:6504713)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
RPL3 Human Gene Knockout Kit (CRISPR)
KN403343

USD 1,290.00

2 Weeks

RPL3 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN403343 is the updated version of KN203343.
Rpl3 Mouse Gene Knockout Kit (CRISPR)
KN515035

USD 1,290.00

2 Weeks

Rpl3 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN515035 is the updated version of KN315035.
Rpl3 (BC009655) Mouse Tagged ORF Clone
MG206317

USD 330.00

3 Weeks

Rpl3 (GFP-tagged) - Mouse ribosomal protein L3 (cDNA clone MGC:6334 IMAGE:3485069)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Rpl3 (BC094059) Mouse Tagged ORF Clone
MG206324

USD 260.00

3 Weeks

Rpl3 (GFP-tagged) - Mouse ribosomal protein L3 (cDNA clone MGC:102482 IMAGE:3676103)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Rpl3 (BC083134) Mouse Tagged ORF Clone
MG206326

USD 260.00

3 Weeks

Rpl3 (GFP-tagged) - Mouse ribosomal protein L3 (cDNA clone MGC:103388 IMAGE:6504713)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Rpl3 (NM_013762) Mouse Tagged ORF Clone
MR206317L3

USD 500.00

3 Weeks

Lenti ORF clone of Rpl3 (Myc-DDK-tagged) - Mouse ribosomal protein L3 (Rpl3)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Rpl3 (NM_013762) Mouse Tagged ORF Clone
MR206317L4

USD 500.00

3 Weeks

Lenti ORF clone of Rpl3 (mGFP-tagged) - Mouse ribosomal protein L3 (Rpl3)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Rpl3 (BC094059) Mouse Tagged ORF Clone
MR206324L3

USD 440.00

3 Weeks

Lenti ORF clone of Rpl3 (Myc-DDK-tagged) - Mouse ribosomal protein L3 (cDNA clone MGC:102482 IMAGE:3676103)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Rpl3 (BC094059) Mouse Tagged ORF Clone Lentiviral Particle
MR206324L3V

USD 640.00

6 Weeks

Lenti ORF particles, Rpl3 (Myc-DDK-tagged) - Mouse ribosomal protein L3 (cDNA clone MGC:102482 IMAGE:3676103), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Rpl3 (BC094059) Mouse Tagged ORF Clone
MR206324L4

USD 440.00

3 Weeks

Lenti ORF clone of Rpl3 (mGFP-tagged) - Mouse ribosomal protein L3 (cDNA clone MGC:102482 IMAGE:3676103)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Rpl3 (BC094059) Mouse Tagged ORF Clone Lentiviral Particle
MR206324L4V

USD 640.00

6 Weeks

Lenti ORF particles, Rpl3 (GFP-tagged) - Mouse ribosomal protein L3 (cDNA clone MGC:102482 IMAGE:3676103), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Rpl3 (BC083134) Mouse Tagged ORF Clone
MR206326L3

USD 440.00

3 Weeks

Lenti ORF clone of Rpl3 (Myc-DDK-tagged) - Mouse ribosomal protein L3 (cDNA clone MGC:103388 IMAGE:6504713)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Rpl3 (BC083134) Mouse Tagged ORF Clone Lentiviral Particle
MR206326L3V

USD 640.00

6 Weeks

Lenti ORF particles, Rpl3 (Myc-DDK-tagged) - Mouse ribosomal protein L3 (cDNA clone MGC:103388 IMAGE:6504713), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Rpl3 (BC083134) Mouse Tagged ORF Clone
MR206326L4

USD 440.00

3 Weeks

Lenti ORF clone of Rpl3 (mGFP-tagged) - Mouse ribosomal protein L3 (cDNA clone MGC:103388 IMAGE:6504713)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Rpl3 (BC083134) Mouse Tagged ORF Clone Lentiviral Particle
MR206326L4V

USD 640.00

6 Weeks

Lenti ORF particles, Rpl3 (GFP-tagged) - Mouse ribosomal protein L3 (cDNA clone MGC:103388 IMAGE:6504713), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RPL3 (NM_000967) Human Tagged ORF Clone
RC203343L3

USD 620.00

3 Weeks

Lenti ORF clone of Human ribosomal protein L3 (RPL3), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RPL3 (NM_000967) Human Tagged ORF Clone Lentiviral Particle
RC203343L3V

USD 820.00

6 Weeks

Lenti ORF particles, RPL3 (Myc-DDK tagged) - Human ribosomal protein L3 (RPL3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RPL3 (NM_000967) Human Tagged ORF Clone
RC203343L4

USD 620.00

3 Weeks

Lenti ORF clone of Human ribosomal protein L3 (RPL3), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RPL3 (NM_000967) Human Tagged ORF Clone Lentiviral Particle
RC203343L4V

USD 820.00

6 Weeks

Lenti ORF particles, RPL3 (mGFP-tagged) - Human ribosomal protein L3 (RPL3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RPL3 (NM_001033853) Human Tagged ORF Clone
RC217987L3

USD 620.00

3 Weeks

Lenti ORF clone of Human ribosomal protein L3 (RPL3), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RPL3 (NM_001033853) Human Tagged ORF Clone Lentiviral Particle
RC217987L3V

USD 820.00

6 Weeks

Lenti ORF particles, RPL3 (Myc-DDK tagged) - Human ribosomal protein L3 (RPL3), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RPL3 (NM_001033853) Human Tagged ORF Clone
RC217987L4

USD 620.00

3 Weeks

Lenti ORF clone of Human ribosomal protein L3 (RPL3), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RPL3 (NM_001033853) Human Tagged ORF Clone Lentiviral Particle
RC217987L4V

USD 820.00

6 Weeks

Lenti ORF particles, RPL3 (mGFP-tagged) - Human ribosomal protein L3 (RPL3), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RPL3 (NM_001033853) Human Tagged ORF Clone
RG217987

USD 460.00

3 Weeks

RPL3 (GFP-tagged) - Human ribosomal protein L3 (RPL3), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Rpl3 (NM_198753) Rat Tagged ORF Clone
RR214863

USD 420.00

4 Weeks

Rpl3 (Myc-DDK-tagged ORF) - Rat ribosomal protein L3 (Rpl3), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Rpl3 (NM_198753) Rat Tagged ORF Clone
RR214863L3

USD 640.00

9 Weeks

Lenti ORF clone of Rpl3 (Myc-DDK-tagged ORF) - Rat ribosomal protein L3 (Rpl3), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Rpl3 (NM_198753) Rat Tagged ORF Clone Lentiviral Particle
RR214863L3V

USD 850.00

13 Weeks

Lenti ORF particles, Rpl3 (Myc-DDK-tagged ORF) - Rat ribosomal protein L3 (Rpl3), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Rpl3 (NM_198753) Rat Tagged ORF Clone
RR214863L4

USD 700.00

9 Weeks

Lenti ORF clone of Rpl3 (mGFP-tagged ORF) - Rat ribosomal protein L3 (Rpl3), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Rpl3 (NM_198753) Rat Tagged ORF Clone Lentiviral Particle
RR214863L4V

USD 960.00

13 Weeks

Lenti ORF particles, Rpl3 (GFP-tagged ORF) - Rat ribosomal protein L3 (Rpl3), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RPL3 Rabbit Polyclonal Antibody
TA314452

USD 345.00

In Stock

Rabbit polyclonal anti-RPL3 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RPL3.
RPL3 Rabbit Polyclonal Antibody
TA346542

USD 475.00

5 Days

Rabbit Polyclonal Anti-RPL3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RPL3 antibody: synthetic peptide directed towards the N terminal of human RPL3. Synthetic peptide located within the following region: DPSKPVHLTAFLGYKAGMTHIVREVDRPGSKVNKKEVVEAVTIVETPPMV
RPL3 Rabbit Polyclonal Antibody
TA346543

USD 475.00

5 Days

Rabbit Polyclonal Anti-RPL3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RPL3 antibody: synthetic peptide directed towards the C terminal of human RPL3. Synthetic peptide located within the following region: YHHRTEINKKIYKIGQGYLIKDGKLIKNNASTDYDLSDKSINPLGGFVHY
RPL3 (NM_000967) Human Over-expression Lysate
LY424411

USD 396.00

In Stock

Transient overexpression lysate of ribosomal protein L3 (RPL3), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
RPL3 (NM_001033853) Human Untagged Clone
SC302771

USD 600.00

In Stock

RPL3 (untagged)-Human ribosomal protein L3 (RPL3), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
RPL3 (NM_000967) Human Untagged Clone
SC319712

USD 310.00

In Stock

RPL3 (untagged)-Human ribosomal protein L3 (RPL3), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
RPL3 (NM_000967) Human Over-expression Lysate
LC424411

USD 121.00

In Stock

RPL3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
RPL3 (NM_000967) Human Recombinant Protein
TP761414

USD 215.00

In Stock

Purified recombinant protein of Human ribosomal protein L3 (RPL3), transcript variant 1, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug

Tag N-GST and C-His
Expression Host E. coli
Human RPL3 activation kit by CRISPRa
GA104143

USD 1,290.00

2 Weeks

RPL3 CRISPRa kit - CRISPR gene activation of human ribosomal protein L3

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Rpl3 activation kit by CRISPRa
GA205127

USD 1,290.00

2 Weeks

Rpl3 CRISPRa kit - CRISPR gene activation of mouse ribosomal protein L3

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
RPL3 Human qPCR Template Standard (NM_000967)
HK206392

USD 330.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene RPL3

Application Plasmid of exact quantity for transcript copy number calculation
RPL3 Human qPCR Template Standard (NM_000967)
HK206393

USD 330.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene RPL3

Application Plasmid of exact quantity for transcript copy number calculation
RPL3 Human qPCR Primer Pair (NM_000967)
HP200904

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene RPL3

Component 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions)