Germany
Japan
United Kingdom
China
RPL32 (Myc-DDK-tagged)-Human ribosomal protein L32 (RPL32), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
RPL32 (Myc-DDK-tagged)-Human ribosomal protein L32 (RPL32), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
RPL32 (Myc-DDK-tagged)-Human ribosomal protein L32 (RPL32), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
RPL32 (GFP-tagged) - Human ribosomal protein L32 (RPL32), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
RPL32 (GFP-tagged) - Human ribosomal protein L32 (RPL32), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human ribosomal protein L32 (RPL32), transcript variant 3, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, RPL32 (Myc-DDK tagged) - Human ribosomal protein L32 (RPL32), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human ribosomal protein L32 (RPL32), transcript variant 3, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, RPL32 (mGFP-tagged) - Human ribosomal protein L32 (RPL32), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human ribosomal protein L32 (RPL32), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, RPL32 (Myc-DDK tagged) - Human ribosomal protein L32 (RPL32), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human ribosomal protein L32 (RPL32), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, RPL32 (mGFP-tagged) - Human ribosomal protein L32 (RPL32), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human ribosomal protein L32 (RPL32), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, RPL32 (Myc-DDK tagged) - Human ribosomal protein L32 (RPL32), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human ribosomal protein L32 (RPL32), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, RPL32 (mGFP-tagged) - Human ribosomal protein L32 (RPL32), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
RPL32 (GFP-tagged) - Human ribosomal protein L32 (RPL32), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
RPL32 (untagged)-Human ribosomal protein L32 (RPL32), transcript variant 1
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-RPL32 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RPL32 antibody: synthetic peptide directed towards the N terminal of human RPL32. Synthetic peptide located within the following region: AALRPLVKPKIVKKRTKKFIRHQSDRYVKIKRNWRKPRGIDNRVRRRFKG |
RPL32 (untagged)-Human ribosomal protein L32 (RPL32), transcript variant 3
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Recombinant protein of human ribosomal protein L32 (RPL32), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
Purified recombinant protein of Human ribosomal protein L32 (RPL32), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
Transient overexpression lysate of ribosomal protein L32 (RPL32), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
LY423576 is the same product as LY425202.
RPL32 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
RPL32 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
RPL32 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
RPL32 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
RPL32 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of ribosomal protein L32 (RPL32), transcript variant 3
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
LY423577 is the same product as LY425203.
Transient overexpression lysate of ribosomal protein L32 (RPL32), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of ribosomal protein L32 (RPL32), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of ribosomal protein L32 (RPL32), transcript variant 3
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
RPL32 (untagged)-Human ribosomal protein L32 (RPL32), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression of RPL32 (NM_001007074) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of RPL32 (NM_000994) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of RPL32 (NM_001007073) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of RPL32 (NM_001007074) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of RPL32 (NM_001007074) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of RPL32 (NM_000994) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of RPL32 (NM_000994) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of RPL32 (NM_001007073) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of RPL32 (NM_001007073) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- RPL32
Pathways
- Ribosome