Germany
Japan
United Kingdom
China
RPLP2 (Myc-DDK-tagged)-Human ribosomal protein, large, P2 (RPLP2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti-ORF clone of RPLP2 (Myc-DDK-tagged)-Human ribosomal protein, large, P2 (RPLP2)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, RPLP2 (Myc-DDK-tagged)-Human ribosomal protein, large, P2 (RPLP2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of RPLP2 (mGFP-tagged)-Human ribosomal protein, large, P2 (RPLP2)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, RPLP2 (mGFP-tagged)-Human ribosomal protein, large, P2 (RPLP2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
RPLP2 (GFP-tagged) - Human ribosomal protein, large, P2 (RPLP2)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
RPLP2 (untagged)-Human ribosomal protein, large, P2 (RPLP2)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
RPLP2 (untagged)-Human ribosomal protein, large, P2 (RPLP2)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit polyclonal anti-RPLP2 antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RPLP2. |
RPLP2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of ribosomal protein, large, P2 (RPLP2)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
RPLP2 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 20~49 amino acids from the N-terminal region of Human RPLP2. |
Rabbit Polyclonal Anti-RPLP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RPLP2 antibody is: synthetic peptide directed towards the N-terminal region of Human RPLP2. Synthetic peptide located within the following region: MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKN |
RPLP2 (1-115, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
RPLP2 (1-115, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
Rabbit Polyclonal Anti-RPLP2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human RPLP2 |
Transient overexpression of RPLP2 (NM_001004) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of RPLP2 (NM_001004) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of RPLP2 (NM_001004) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- RPLP2
Pathways
- Ribosome