Products

cDNA Clones (43)
Proteins (22)
Antibodies (2)
Jump to Filters
View as table Download
RPS24 (NM_033022) Human Tagged ORF Clone
RC210033

USD 98.00

USD 390.00

In Stock

RPS24 (Myc-DDK-tagged)-Human ribosomal protein S24 (RPS24), transcript variant a

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
RPS24 (NM_001142285) Human Tagged ORF Clone
RC226724

USD 420.00

In Stock

RPS24 (Myc-DDK-tagged)-Human ribosomal protein S24 (RPS24), transcript variant d

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
RPS24 (NM_033022) Human Tagged ORF Clone
RG210033

USD 460.00

In Stock

RPS24 (GFP-tagged) - Human ribosomal protein S24 (RPS24), transcript variant a

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
RPS24 (NM_033022) Human Tagged ORF Clone
RC210033L3

USD 620.00

3 Weeks

Lenti ORF clone of Human ribosomal protein S24 (RPS24), transcript variant a, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RPS24 (NM_033022) Human Tagged ORF Clone Lentiviral Particle
RC210033L3V

USD 820.00

6 Weeks

Lenti ORF particles, RPS24 (Myc-DDK tagged) - Human ribosomal protein S24 (RPS24), transcript variant a, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RPS24 (NM_033022) Human Tagged ORF Clone
RC210033L4

USD 620.00

3 Weeks

Lenti ORF clone of Human ribosomal protein S24 (RPS24), transcript variant a, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RPS24 (NM_033022) Human Tagged ORF Clone Lentiviral Particle
RC210033L4V

USD 820.00

6 Weeks

Lenti ORF particles, RPS24 (mGFP-tagged) - Human ribosomal protein S24 (RPS24), transcript variant a, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RPS24 (NM_001026) Human Tagged ORF Clone
RC224106

USD 420.00

3 Weeks

RPS24 (Myc-DDK-tagged)-Human ribosomal protein S24 (RPS24), transcript variant c

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
RPS24 (NM_001026) Human Tagged ORF Clone
RC224106L3

USD 620.00

8 Weeks

Lenti-ORF clone of RPS24 (Myc-DDK-tagged)-Human ribosomal protein S24 (RPS24), transcript variant c

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RPS24 (NM_001026) Human Tagged ORF Clone Lentiviral Particle
RC224106L3V

USD 820.00

11 Weeks

Lenti ORF particles, RPS24 (Myc-DDK-tagged)-Human ribosomal protein S24 (RPS24), transcript variant c, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RPS24 (NM_001026) Human Tagged ORF Clone
RC224106L4

USD 620.00

8 Weeks

Lenti-ORF clone of RPS24 (mGFP-tagged)-Human ribosomal protein S24 (RPS24), transcript variant c

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RPS24 (NM_001026) Human Tagged ORF Clone Lentiviral Particle
RC224106L4V

USD 820.00

11 Weeks

Lenti ORF particles, RPS24 (mGFP-tagged)-Human ribosomal protein S24 (RPS24), transcript variant c, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RPS24 (NM_001142282) Human Tagged ORF Clone
RC226596

USD 420.00

3 Weeks

RPS24 (Myc-DDK-tagged)-Human ribosomal protein S24 (RPS24), transcript variant f

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
RPS24 (NM_001142282) Human Tagged ORF Clone
RC226596L3

USD 620.00

8 Weeks

Lenti-ORF clone of RPS24 (Myc-DDK-tagged)-Human ribosomal protein S24 (RPS24), transcript variant f

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RPS24 (NM_001142282) Human Tagged ORF Clone Lentiviral Particle
RC226596L3V

USD 820.00

11 Weeks

Lenti ORF particles, RPS24 (Myc-DDK-tagged)-Human ribosomal protein S24 (RPS24), transcript variant f, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RPS24 (NM_001142282) Human Tagged ORF Clone
RC226596L4

USD 620.00

8 Weeks

Lenti-ORF clone of RPS24 (mGFP-tagged)-Human ribosomal protein S24 (RPS24), transcript variant f

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RPS24 (NM_001142282) Human Tagged ORF Clone Lentiviral Particle
RC226596L4V

USD 820.00

11 Weeks

Lenti ORF particles, RPS24 (mGFP-tagged)-Human ribosomal protein S24 (RPS24), transcript variant f, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RPS24 (NM_001142285) Human Tagged ORF Clone
RC226724L3

USD 620.00

3 Weeks

Lenti ORF clone of Human ribosomal protein S24 (RPS24), transcript variant d, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RPS24 (NM_001142285) Human Tagged ORF Clone Lentiviral Particle
RC226724L3V

USD 820.00

6 Weeks

Lenti ORF particles, RPS24 (Myc-DDK tagged) - Human ribosomal protein S24 (RPS24), transcript variant d, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RPS24 (NM_001142285) Human Tagged ORF Clone
RC226724L4

USD 620.00

3 Weeks

Lenti ORF clone of Human ribosomal protein S24 (RPS24), transcript variant d, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RPS24 (NM_001142285) Human Tagged ORF Clone Lentiviral Particle
RC226724L4V

USD 820.00

6 Weeks

Lenti ORF particles, RPS24 (mGFP-tagged) - Human ribosomal protein S24 (RPS24), transcript variant d, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RPS24 (NM_001142284) Human Tagged ORF Clone
RC227088

USD 420.00

3 Weeks

RPS24 (Myc-DDK-tagged)-Human ribosomal protein S24 (RPS24), transcript variant b

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
RPS24 (NM_001142284) Human Tagged ORF Clone
RC227088L3

USD 620.00

8 Weeks

Lenti-ORF clone of RPS24 (Myc-DDK-tagged)-Human ribosomal protein S24 (RPS24), transcript variant b

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RPS24 (NM_001142284) Human Tagged ORF Clone Lentiviral Particle
RC227088L3V

USD 820.00

11 Weeks

Lenti ORF particles, RPS24 (Myc-DDK-tagged)-Human ribosomal protein S24 (RPS24), transcript variant b, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RPS24 (NM_001142284) Human Tagged ORF Clone
RC227088L4

USD 620.00

8 Weeks

Lenti-ORF clone of RPS24 (mGFP-tagged)-Human ribosomal protein S24 (RPS24), transcript variant b

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RPS24 (NM_001142284) Human Tagged ORF Clone Lentiviral Particle
RC227088L4V

USD 820.00

11 Weeks

Lenti ORF particles, RPS24 (mGFP-tagged)-Human ribosomal protein S24 (RPS24), transcript variant b, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RPS24 (NM_001142283) Human Tagged ORF Clone
RC227907

USD 420.00

3 Weeks

RPS24 (Myc-DDK-tagged)-Human ribosomal protein S24 (RPS24), transcript variant e

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
RPS24 (NM_001142283) Human Tagged ORF Clone
RC227907L3

USD 620.00

8 Weeks

Lenti-ORF clone of RPS24 (Myc-DDK-tagged)-Human ribosomal protein S24 (RPS24), transcript variant e

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RPS24 (NM_001142283) Human Tagged ORF Clone Lentiviral Particle
RC227907L3V

USD 820.00

11 Weeks

Lenti ORF particles, RPS24 (Myc-DDK-tagged)-Human ribosomal protein S24 (RPS24), transcript variant e, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RPS24 (NM_001142283) Human Tagged ORF Clone
RC227907L4

USD 620.00

8 Weeks

Lenti-ORF clone of RPS24 (mGFP-tagged)-Human ribosomal protein S24 (RPS24), transcript variant e

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RPS24 (NM_001142283) Human Tagged ORF Clone Lentiviral Particle
RC227907L4V

USD 820.00

11 Weeks

Lenti ORF particles, RPS24 (mGFP-tagged)-Human ribosomal protein S24 (RPS24), transcript variant e, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RPS24 (NM_001026) Human Tagged ORF Clone
RG224106

USD 460.00

3 Weeks

RPS24 (GFP-tagged) - Human ribosomal protein S24 (RPS24), transcript variant c

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
RPS24 (NM_001142282) Human Tagged ORF Clone
RG226596

USD 460.00

3 Weeks

RPS24 (GFP-tagged) - Human ribosomal protein S24 (RPS24), transcript variant f

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
RPS24 (NM_001142285) Human Tagged ORF Clone
RG226724

USD 460.00

3 Weeks

RPS24 (GFP-tagged) - Human ribosomal protein S24 (RPS24), transcript variant d

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
RPS24 (NM_001142284) Human Tagged ORF Clone
RG227088

USD 460.00

3 Weeks

RPS24 (GFP-tagged) - Human ribosomal protein S24 (RPS24), transcript variant b

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
RPS24 (NM_001142283) Human Tagged ORF Clone
RG227907

USD 460.00

3 Weeks

RPS24 (GFP-tagged) - Human ribosomal protein S24 (RPS24), transcript variant e

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
RPS24 (NM_001026) Human Untagged Clone
SC126685

USD 420.00

In Stock

RPS24 (untagged)-Human ribosomal protein S24 (RPS24), transcript variant c

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
RPS24 Rabbit Polyclonal Antibody
TA345744

USD 475.00

5 Days

Rabbit Polyclonal Anti-RPS24 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RPS24 antibody: synthetic peptide directed towards the middle region of human RPS24. Synthetic peptide located within the following region: GFGMIYDSLDYAKKNEPKHRLARHGLYEKKKTSRKQRKERKNRMKKVRGT
RPS24 (NM_033022) Human Untagged Clone
SC101869

USD 310.00

In Stock

RPS24 (untagged)-Human ribosomal protein S24 (RPS24), transcript variant a

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
RPS24 (AK094613) Human Untagged Clone
SC102477

USD 660.00

In Stock

(untagged)-Human cDNA FLJ37294 fis, clone BRAMY2015211

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
RPS24 (Center) Rabbit Polyclonal Antibody
AP53738PU-N

USD 450.00

2 Weeks

RPS24 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 72~101 amino acids from the Central region of Human RPS24
RPS24 (1-130, His-tag) Human Protein
AR51033PU-N

USD 845.00

2 Weeks

RPS24 (1-130, His-tag) human protein, 0.1 mg

Tag His-tag
Expression Host E. coli
RPS24 (1-130, His-tag) Human Protein
AR51033PU-S

USD 330.00

2 Weeks

RPS24 (1-130, His-tag) human protein, 20 µg

Tag His-tag
Expression Host E. coli
RPS24 (NM_033022) Human Over-expression Lysate
LC409783

USD 121.00

2 Weeks

RPS24 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
RPS24 (NM_001142285) Human Over-expression Lysate
LC428008

USD 121.00

2 Weeks

RPS24 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
RPS24 (NM_033022) Human Over-expression Lysate
LY409783

USD 396.00

5 Days

Transient overexpression lysate of ribosomal protein S24 (RPS24), transcript variant a

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
RPS24 (NM_001142285) Human Over-expression Lysate
LY428008

USD 396.00

5 Days

Transient overexpression lysate of ribosomal protein S24 (RPS24), transcript variant d

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
RPS24 (NM_033022) Human Mass Spec Standard
PH310033

USD 2,055.00

3 Weeks

RPS24 MS Standard C13 and N15-labeled recombinant protein (NP_148982)

Tag C-Myc/DDK
Expression Host HEK293
RPS24 (NM_001142282) Human Untagged Clone
SC324725

USD 420.00

3 Weeks

RPS24 (untagged)-Human ribosomal protein S24 (RPS24), transcript variant f

Vector pCMV6 series
Tag Tag Free