AHCYL1 (Myc-DDK-tagged)-Human adenosylhomocysteinase-like 1 (AHCYL1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
AHCYL1 (Myc-DDK-tagged)-Human adenosylhomocysteinase-like 1 (AHCYL1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human S-adenosylhomocysteine hydrolase-like 1 (AHCYL1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, AHCYL1 (Myc-DDK tagged) - Human adenosylhomocysteinase-like 1 (AHCYL1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, AHCYL1 (mGFP-tagged) - Human adenosylhomocysteinase-like 1 (AHCYL1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF clone of Human adenosylhomocysteinase-like 1 (AHCYL1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, AHCYL1 (Myc-DDK tagged) - Human adenosylhomocysteinase-like 1 (AHCYL1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human adenosylhomocysteinase-like 1 (AHCYL1), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, AHCYL1 (mGFP-tagged) - Human adenosylhomocysteinase-like 1 (AHCYL1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
AHCYL1 (Myc-DDK tagged) - Homo sapiens adenosylhomocysteinase-like 1 (AHCYL1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
AHCYL1 (Myc-DDK tagged) - Homo sapiens adenosylhomocysteinase-like 1 (AHCYL1), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
AHCYL1 (Myc-DDK tagged) - Homo sapiens adenosylhomocysteinase-like 1 (AHCYL1), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
AHCYL1 (Myc-DDK tagged) - Homo sapiens adenosylhomocysteinase-like 1 (AHCYL1), transcript variant 5
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
AHCYL1 (GFP-tagged) - Human adenosylhomocysteinase-like 1 (AHCYL1)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
AHCYL1 (GFP-tagged) - Homo sapiens adenosylhomocysteinase-like 1 (AHCYL1), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
AHCYL1 (GFP-tagged) - Homo sapiens adenosylhomocysteinase-like 1 (AHCYL1), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
AHCYL1 (GFP-tagged) - Homo sapiens adenosylhomocysteinase-like 1 (AHCYL1), transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
AHCYL1 (GFP-tagged) - Homo sapiens adenosylhomocysteinase-like 1 (AHCYL1), transcript variant 5
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Homo sapiens adenosylhomocysteinase-like 1 (AHCYL1) transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human adenosylhomocysteinase-like 1 (AHCYL1), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
AHCYL1 (untagged)-Human adenosylhomocysteinase-like 1 (AHCYL1)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
AHCYL1 (untagged)-Human adenosylhomocysteinase-like 1 (AHCYL1)
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-AHCYL1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-AHCYL1 Antibody: synthetic peptide directed towards the N terminal of human AHCYL1. Synthetic peptide located within the following region: TDSYSSAASYTDSSDDEVSPREKQQTNSKGSSNFCVKNIKQAEFGRREIE |
Rabbit Polyclonal Anti-AHCYL1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-AHCYL1 Antibody: synthetic peptide directed towards the N terminal of human AHCYL1. Synthetic peptide located within the following region: MSMPDAMPLPGVGEELKQAKEIEDAEKYSFMATVTKAPKKQIQFADDMQE |
AHCYL1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of adenosylhomocysteinase-like 1 (AHCYL1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
AHCYL1 MS Standard C13 and N15-labeled recombinant protein (NP_006612)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
AHCYL1 (untagged) - Homo sapiens adenosylhomocysteinase-like 1 (AHCYL1), transcript variant 2
Vector | pCMV6 series |
Tag | Tag Free |
AHCYL1 (untagged) - Homo sapiens adenosylhomocysteinase-like 1 (AHCYL1), transcript variant 3
Vector | pCMV6 series |
Tag | Tag Free |
AHCYL1 (untagged) - Homo sapiens adenosylhomocysteinase-like 1 (AHCYL1), transcript variant 4
Vector | pCMV6 series |
Tag | Tag Free |
AHCYL1 (untagged) - Homo sapiens adenosylhomocysteinase-like 1 (AHCYL1), transcript variant 5
Vector | pCMV6 series |
Tag | Tag Free |
Transient overexpression of AHCYL1 (NM_006621) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of AHCYL1 (NM_001242673) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of AHCYL1 (NM_001242674) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of AHCYL1 (NM_001242675) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of AHCYL1 (NM_001242676) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of AHCYL1 (NM_006621) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of AHCYL1 (NM_006621) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of AHCYL1 (NM_001242673) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of AHCYL1 (NM_001242674) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of AHCYL1 (NM_001242675) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of AHCYL1 (NM_001242676) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack