Products

View as table Download

AHCYL1 (Myc-DDK-tagged)-Human adenosylhomocysteinase-like 1 (AHCYL1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, AHCYL1 (mGFP-tagged) - Human adenosylhomocysteinase-like 1 (AHCYL1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

Lenti ORF clone of Human adenosylhomocysteinase-like 1 (AHCYL1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human adenosylhomocysteinase-like 1 (AHCYL1), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, AHCYL1 (mGFP-tagged) - Human adenosylhomocysteinase-like 1 (AHCYL1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

AHCYL1 (Myc-DDK tagged) - Homo sapiens adenosylhomocysteinase-like 1 (AHCYL1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

AHCYL1 (Myc-DDK tagged) - Homo sapiens adenosylhomocysteinase-like 1 (AHCYL1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

AHCYL1 (Myc-DDK tagged) - Homo sapiens adenosylhomocysteinase-like 1 (AHCYL1), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

AHCYL1 (Myc-DDK tagged) - Homo sapiens adenosylhomocysteinase-like 1 (AHCYL1), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

AHCYL1 (GFP-tagged) - Human adenosylhomocysteinase-like 1 (AHCYL1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

AHCYL1 (GFP-tagged) - Homo sapiens adenosylhomocysteinase-like 1 (AHCYL1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

AHCYL1 (GFP-tagged) - Homo sapiens adenosylhomocysteinase-like 1 (AHCYL1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

AHCYL1 (GFP-tagged) - Homo sapiens adenosylhomocysteinase-like 1 (AHCYL1), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

AHCYL1 (GFP-tagged) - Homo sapiens adenosylhomocysteinase-like 1 (AHCYL1), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Homo sapiens adenosylhomocysteinase-like 1 (AHCYL1) transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human adenosylhomocysteinase-like 1 (AHCYL1), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

AHCYL1 (untagged)-Human adenosylhomocysteinase-like 1 (AHCYL1)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

AHCYL1 (untagged)-Human adenosylhomocysteinase-like 1 (AHCYL1)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

Rabbit Polyclonal Anti-AHCYL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-AHCYL1 Antibody: synthetic peptide directed towards the N terminal of human AHCYL1. Synthetic peptide located within the following region: TDSYSSAASYTDSSDDEVSPREKQQTNSKGSSNFCVKNIKQAEFGRREIE

Rabbit Polyclonal Anti-AHCYL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-AHCYL1 Antibody: synthetic peptide directed towards the N terminal of human AHCYL1. Synthetic peptide located within the following region: MSMPDAMPLPGVGEELKQAKEIEDAEKYSFMATVTKAPKKQIQFADDMQE

AHCYL1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of adenosylhomocysteinase-like 1 (AHCYL1)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

AHCYL1 MS Standard C13 and N15-labeled recombinant protein (NP_006612)

Tag C-Myc/DDK
Expression Host HEK293

AHCYL1 (untagged) - Homo sapiens adenosylhomocysteinase-like 1 (AHCYL1), transcript variant 2

Vector pCMV6 series
Tag Tag Free

AHCYL1 (untagged) - Homo sapiens adenosylhomocysteinase-like 1 (AHCYL1), transcript variant 3

Vector pCMV6 series
Tag Tag Free

AHCYL1 (untagged) - Homo sapiens adenosylhomocysteinase-like 1 (AHCYL1), transcript variant 4

Vector pCMV6 series
Tag Tag Free

AHCYL1 (untagged) - Homo sapiens adenosylhomocysteinase-like 1 (AHCYL1), transcript variant 5

Vector pCMV6 series
Tag Tag Free

Transient overexpression of AHCYL1 (NM_006621) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of AHCYL1 (NM_001242673) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of AHCYL1 (NM_001242674) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of AHCYL1 (NM_001242675) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of AHCYL1 (NM_001242676) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of AHCYL1 (NM_006621) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of AHCYL1 (NM_006621) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of AHCYL1 (NM_001242673) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of AHCYL1 (NM_001242674) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of AHCYL1 (NM_001242675) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of AHCYL1 (NM_001242676) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack