Germany
Japan
United Kingdom
China
AHCYL1 (Myc-DDK-tagged)-Human adenosylhomocysteinase-like 1 (AHCYL1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human S-adenosylhomocysteine hydrolase-like 1 (AHCYL1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Ahcyl1 (Myc-DDK-tagged) - Mouse S-adenosylhomocysteine hydrolase-like 1 (Ahcyl1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, AHCYL1 (Myc-DDK tagged) - Human adenosylhomocysteinase-like 1 (AHCYL1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, AHCYL1 (mGFP-tagged) - Human adenosylhomocysteinase-like 1 (AHCYL1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
AHCYL1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN401940 is the updated version of KN201940.
Ahcyl1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN501007 is the updated version of KN301007.
Ahcyl1 (GFP-tagged) - Mouse S-adenosylhomocysteine hydrolase-like 1 (Ahcyl1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Ahcyl1 (Myc-DDK-tagged) - Mouse S-adenosylhomocysteine hydrolase-like 1 (Ahcyl1)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ahcyl1 (Myc-DDK-tagged) - Mouse S-adenosylhomocysteine hydrolase-like 1 (Ahcyl1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Ahcyl1 (mGFP-tagged) - Mouse S-adenosylhomocysteine hydrolase-like 1 (Ahcyl1)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ahcyl1 (GFP-tagged) - Mouse S-adenosylhomocysteine hydrolase-like 1 (Ahcyl1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human adenosylhomocysteinase-like 1 (AHCYL1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, AHCYL1 (Myc-DDK tagged) - Human adenosylhomocysteinase-like 1 (AHCYL1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human adenosylhomocysteinase-like 1 (AHCYL1), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, AHCYL1 (mGFP-tagged) - Human adenosylhomocysteinase-like 1 (AHCYL1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
AHCYL1 (Myc-DDK tagged) - Homo sapiens adenosylhomocysteinase-like 1 (AHCYL1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
AHCYL1 (Myc-DDK tagged) - Homo sapiens adenosylhomocysteinase-like 1 (AHCYL1), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
AHCYL1 (Myc-DDK tagged) - Homo sapiens adenosylhomocysteinase-like 1 (AHCYL1), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
AHCYL1 (Myc-DDK tagged) - Homo sapiens adenosylhomocysteinase-like 1 (AHCYL1), transcript variant 5
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
AHCYL1 (GFP-tagged) - Human adenosylhomocysteinase-like 1 (AHCYL1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
AHCYL1 (GFP-tagged) - Homo sapiens adenosylhomocysteinase-like 1 (AHCYL1), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
AHCYL1 (GFP-tagged) - Homo sapiens adenosylhomocysteinase-like 1 (AHCYL1), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
AHCYL1 (GFP-tagged) - Homo sapiens adenosylhomocysteinase-like 1 (AHCYL1), transcript variant 4
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
AHCYL1 (GFP-tagged) - Homo sapiens adenosylhomocysteinase-like 1 (AHCYL1), transcript variant 5
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Ahcyl1 (Myc-DDK-tagged ORF) - Rat S-adenosylhomocysteine hydrolase-like 1 (Ahcyl1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Ahcyl1 (Myc-DDK-tagged ORF) - Rat S-adenosylhomocysteine hydrolase-like 1 (Ahcyl1), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ahcyl1 (Myc-DDK-tagged ORF) - Rat S-adenosylhomocysteine hydrolase-like 1 (Ahcyl1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Ahcyl1 (mGFP-tagged ORF) - Rat S-adenosylhomocysteine hydrolase-like 1 (Ahcyl1), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ahcyl1 (GFP-tagged ORF) - Rat S-adenosylhomocysteine hydrolase-like 1 (Ahcyl1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Homo sapiens adenosylhomocysteinase-like 1 (AHCYL1) transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Ahcyl1 (untagged) - Mouse S-adenosylhomocysteine hydrolase-like 1 (Ahcyl1), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human adenosylhomocysteinase-like 1 (AHCYL1), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
AHCYL1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
AHCYL1 (untagged)-Human adenosylhomocysteinase-like 1 (AHCYL1)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
AHCYL1 (untagged)-Human adenosylhomocysteinase-like 1 (AHCYL1)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-AHCYL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-AHCYL1 Antibody: synthetic peptide directed towards the N terminal of human AHCYL1. Synthetic peptide located within the following region: TDSYSSAASYTDSSDDEVSPREKQQTNSKGSSNFCVKNIKQAEFGRREIE |
Rabbit Polyclonal Anti-AHCYL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-AHCYL1 Antibody: synthetic peptide directed towards the N terminal of human AHCYL1. Synthetic peptide located within the following region: MSMPDAMPLPGVGEELKQAKEIEDAEKYSFMATVTKAPKKQIQFADDMQE |
AHCYL1 CRISPRa kit - CRISPR gene activation of human adenosylhomocysteinase like 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Ahcyl1 CRISPRa kit - CRISPR gene activation of mouse S-adenosylhomocysteine hydrolase-like 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene AHCYL1
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene AHCYL1
AHCYL1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of adenosylhomocysteinase-like 1 (AHCYL1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
qPCR primer pairs and template standards against Mus musculus gene Ahcyl1
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Mus musculus gene Ahcyl1
AHCYL1 MS Standard C13 and N15-labeled recombinant protein (NP_006612)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Ahcyl1 (untagged ORF) - Rat S-adenosylhomocysteine hydrolase-like 1 (Ahcyl1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
AHCYL1 (untagged) - Homo sapiens adenosylhomocysteinase-like 1 (AHCYL1), transcript variant 2
| Vector | pCMV6 series |
| Tag | Tag Free |
AHCYL1 (untagged) - Homo sapiens adenosylhomocysteinase-like 1 (AHCYL1), transcript variant 3
| Vector | pCMV6 series |
| Tag | Tag Free |
Active filters
Target Symbol
- AHCYL1