Products

View as table Download

LCMT2 (Myc-DDK-tagged)-Human leucine carboxyl methyltransferase 2 (LCMT2)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Recombinant protein of human leucine carboxyl methyltransferase 2 (LCMT2)

Tag C-Myc/DDK
Expression Host HEK293T

LCMT2 (GFP-tagged) - Human leucine carboxyl methyltransferase 2 (LCMT2)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human leucine carboxyl methyltransferase 2 (LCMT2), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, LCMT2 (Myc-DDK tagged) - Human leucine carboxyl methyltransferase 2 (LCMT2), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human leucine carboxyl methyltransferase 2 (LCMT2), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, LCMT2 (mGFP-tagged) - Human leucine carboxyl methyltransferase 2 (LCMT2), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Rabbit Polyclonal Anti-LCMT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LCMT2 antibody: synthetic peptide directed towards the C terminal of human LCMT2. Synthetic peptide located within the following region: PVLSDWHFLHVGTMAWVRIPVEGEVPEARHSHSACTWQGGALIAGGLGAS

Rabbit Polyclonal TYW4 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TYW4 antibody was raised against a 16 amino acid synthetic peptide near the amino terminus of human TYW4.

LCMT2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

LCMT2 (untagged)-Human leucine carboxyl methyltransferase 2 (LCMT2)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

LCMT2 MS Standard C13 and N15-labeled recombinant protein (NP_055608)

Tag C-Myc/DDK
Expression Host HEK293

Transient overexpression of LCMT2 (NM_014793) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of LCMT2 (NM_014793) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of LCMT2 (NM_014793) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack