LCMT2 (Myc-DDK-tagged)-Human leucine carboxyl methyltransferase 2 (LCMT2)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
LCMT2 (Myc-DDK-tagged)-Human leucine carboxyl methyltransferase 2 (LCMT2)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human leucine carboxyl methyltransferase 2 (LCMT2)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
LCMT2 (GFP-tagged) - Human leucine carboxyl methyltransferase 2 (LCMT2)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human leucine carboxyl methyltransferase 2 (LCMT2), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, LCMT2 (Myc-DDK tagged) - Human leucine carboxyl methyltransferase 2 (LCMT2), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human leucine carboxyl methyltransferase 2 (LCMT2), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, LCMT2 (mGFP-tagged) - Human leucine carboxyl methyltransferase 2 (LCMT2), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Rabbit Polyclonal Anti-LCMT2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LCMT2 antibody: synthetic peptide directed towards the C terminal of human LCMT2. Synthetic peptide located within the following region: PVLSDWHFLHVGTMAWVRIPVEGEVPEARHSHSACTWQGGALIAGGLGAS |
Rabbit Polyclonal TYW4 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | TYW4 antibody was raised against a 16 amino acid synthetic peptide near the amino terminus of human TYW4. |
LCMT2 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of leucine carboxyl methyltransferase 2 (LCMT2)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
LCMT2 (untagged)-Human leucine carboxyl methyltransferase 2 (LCMT2)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
LCMT2 MS Standard C13 and N15-labeled recombinant protein (NP_055608)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Transient overexpression of LCMT2 (NM_014793) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of LCMT2 (NM_014793) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of LCMT2 (NM_014793) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack