TRMT11 (Myc-DDK-tagged)-Human tRNA methyltransferase 11 homolog (S. cerevisiae) (TRMT11)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
TRMT11 (Myc-DDK-tagged)-Human tRNA methyltransferase 11 homolog (S. cerevisiae) (TRMT11)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human tRNA methyltransferase 11 homolog (S. cerevisiae) (TRMT11)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
TRMT11 (GFP-tagged) - Human tRNA methyltransferase 11 homolog (S. cerevisiae) (TRMT11)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human tRNA methyltransferase 11 homolog (S. cerevisiae) (TRMT11), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, TRMT11 (Myc-DDK tagged) - Human tRNA methyltransferase 11 homolog (S. cerevisiae) (TRMT11), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human tRNA methyltransferase 11 homolog (S. cerevisiae) (TRMT11), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, TRMT11 (mGFP-tagged) - Human tRNA methyltransferase 11 homolog (S. cerevisiae) (TRMT11), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Rabbit Polyclonal Anti-TRMT11 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TRMT11 antibody: synthetic peptide directed towards the N terminal of human TRMT11. Synthetic peptide located within the following region: IKIHTFNKTLTQEEKIKRIDALEFLPFEGKVNLKKPQHVFSVLEDYGLDP |
TRMT11 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of tRNA methyltransferase 11 homolog (S. cerevisiae) (TRMT11)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
TRMT11 (untagged)-Human tRNA methyltransferase 11 homolog (S. cerevisiae) (TRMT11)
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit polyclonal anti-TRMT11 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human TRMT11. |
TRMT11 MS Standard C13 and N15-labeled recombinant protein (NP_001026882)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Transient overexpression of TRMT11 (NM_001031712) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of TRMT11 (NM_001031712) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of TRMT11 (NM_001031712) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack