Products

cDNA Clones (7)
Proteins (6)
Antibodies (2)
Jump to Filters
View as table Download
Laminin (LAMC3) (NM_006059) Human Tagged ORF Clone
RC218146L4

USD 1,850.00

3 Weeks

Lenti ORF clone of Human laminin, gamma 3 (LAMC3), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Laminin (LAMC3) (NM_006059) Human Tagged ORF Clone
RG218146

USD 1,820.00

3 Weeks

LAMC3 (GFP-tagged) - Human laminin, gamma 3 (LAMC3)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Laminin (LAMC3) Rabbit Polyclonal Antibody
TA315044

USD 345.00

In Stock

Rabbit polyclonal anti-LAMC3 antibody

Applications IF, IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human LAMC3.
Laminin (LAMC3) (NM_006059) Human Over-expression Lysate
LC416892

USD 187.00

In Stock

LAMC3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Laminin (LAMC3) Rabbit Polyclonal Antibody
TA338136

USD 375.00

5 Days

Rabbit Polyclonal Anti-LAMC3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LAMC3 antibody is: synthetic peptide directed towards the C-terminal region of Human LAMC3. Synthetic peptide located within the following region: ERMLGNAAPLSSSAKKKGREAEVLAKDSAKLAKALLRERKQAHRRASRLT
Laminin (LAMC3) (NM_006059) Human Over-expression Lysate
LY416892

USD 605.00

5 Days

Transient overexpression lysate of laminin, gamma 3 (LAMC3)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Laminin (LAMC3) (NM_006059) Human Mass Spec Standard
PH318146

USD 2,055.00

3 Weeks

LAMC3 MS Standard C13 and N15-labeled recombinant protein (NP_006050)

Tag C-Myc/DDK
Expression Host HEK293
Laminin (LAMC3) (NM_006059) Human Untagged Clone
SC303727

USD 3,200.00

3 Weeks

LAMC3 (untagged)-Human laminin, gamma 3 (LAMC3)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Laminin (LAMC3) (NM_006059) ICC Control Block
TB418146

USD 2,300.00

4 Weeks

Transient overexpression of LAMC3 (NM_006059) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Laminin (LAMC3) Cytosection
TS418146

USD 225.00

4 Weeks

Transient overexpression of LAMC3 (NM_006059) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Laminin (LAMC3) Cytosection
TS418146P5

USD 889.00

4 Weeks

Transient overexpression of LAMC3 (NM_006059) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack