Germany
Japan
United Kingdom
China
DHX15 (Myc-DDK-tagged)-Human DEAH (Asp-Glu-Ala-His) box polypeptide 15 (DHX15)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human DEAH (Asp-Glu-Ala-His) box polypeptide 15 (DHX15)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, DHX15 (Myc-DDK tagged) - Human DEAH (Asp-Glu-Ala-His) box polypeptide 15 (DHX15), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, DHX15 (mGFP-tagged) - Human DEAH (Asp-Glu-Ala-His) box polypeptide 15 (DHX15), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF clone of Human DEAH (Asp-Glu-Ala-His) box polypeptide 15 (DHX15), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, DHX15 (Myc-DDK tagged) - Human DEAH (Asp-Glu-Ala-His) box polypeptide 15 (DHX15), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, DHX15 (mGFP-tagged) - Human DEAH (Asp-Glu-Ala-His) box polypeptide 15 (DHX15), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
DHX15 (GFP-tagged) - Human DEAH (Asp-Glu-Ala-His) box polypeptide 15 (DHX15)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human DEAH (Asp-Glu-Ala-His) box polypeptide 15 (DHX15), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human DEAH (Asp-Glu-Ala-His) box polypeptide 15 (DHX15), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human DEAH (Asp-Glu-Ala-His) box polypeptide 15 (DHX15), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
DHX15 (untagged)-Human DEAH (Asp-Glu-Ala-His) box polypeptide 15 (DHX15)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Transient overexpression lysate of DEAH (Asp-Glu-Ala-His) box polypeptide 15 (DHX15)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-DHX15 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DHX15 antibody: synthetic peptide directed towards the N terminal of human DHX15. Synthetic peptide located within the following region: GHTSLPQCINPFTNLPHTPRYYDILKKRLQLPVWEYKDRFTDILVRHQSF |
Rabbit Polyclonal Anti-DHX15 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DHX15 antibody: synthetic peptide directed towards the C terminal of human DHX15. Synthetic peptide located within the following region: YINIRKALVTGYFMQVAHLERTGHYLTVKDNQVVQLHPSTVLDHKPEWVL |
DHX15 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
DHX15 MS Standard C13 and N15-labeled recombinant protein (NP_001349)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Transient overexpression of DHX15 (NM_001358) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of DHX15 (NM_001358) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of DHX15 (NM_001358) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- DHX15
Pathways
- Spliceosome