Products

cDNA Clones (15)
Proteins (9)
Antibodies (2)
Jump to Filters
View as table Download
DHX8 (NM_004941) Human Tagged ORF Clone
RC208403

USD 1,280.00

In Stock

DHX8 (Myc-DDK-tagged)-Human DEAH (Asp-Glu-Ala-His) box polypeptide 8 (DHX8)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
DHX8 (NM_004941) Human Tagged ORF Clone Lentiviral Particle
RC208403L1V

USD 1,680.00

3 Weeks

Lenti ORF particles, DHX8 (Myc-DDK tagged) - Human DEAH (Asp-Glu-Ala-His) box polypeptide 8 (DHX8), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
DHX8 (NM_004941) Human Tagged ORF Clone Lentiviral Particle
RC208403L2V

USD 1,680.00

6 Weeks

Lenti ORF particles, DHX8 (mGFP-tagged) - Human DEAH (Asp-Glu-Ala-His) box polypeptide 8 (DHX8), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
DHX8 (NM_004941) Human Tagged ORF Clone
RG208403

USD 1,410.00

In Stock

DHX8 (GFP-tagged) - Human DEAH (Asp-Glu-Ala-His) box polypeptide 8 (DHX8)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
DHX8 (NM_004941) Human Recombinant Protein
TP308403

USD 823.00

In Stock

Recombinant protein of human DEAH (Asp-Glu-Ala-His) box polypeptide 8 (DHX8)

Tag C-Myc/DDK
Expression Host HEK293T
DHX8 (NM_004941) Human Tagged ORF Clone
RC208403L3

USD 1,480.00

3 Weeks

Lenti ORF clone of Human DEAH (Asp-Glu-Ala-His) box polypeptide 8 (DHX8), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
DHX8 (NM_004941) Human Tagged ORF Clone Lentiviral Particle
RC208403L3V

USD 1,680.00

5 Weeks

Lenti ORF particles, DHX8 (Myc-DDK tagged) - Human DEAH (Asp-Glu-Ala-His) box polypeptide 8 (DHX8), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
DHX8 (NM_004941) Human Tagged ORF Clone
RC208403L4

USD 1,480.00

3 Weeks

Lenti ORF clone of Human DEAH (Asp-Glu-Ala-His) box polypeptide 8 (DHX8), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
DHX8 (NM_004941) Human Tagged ORF Clone Lentiviral Particle
RC208403L4V

USD 1,680.00

7 Weeks

Lenti ORF particles, DHX8 (mGFP-tagged) - Human DEAH (Asp-Glu-Ala-His) box polypeptide 8 (DHX8), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
DHX8 (NM_001302623) Human Tagged ORF Clone
RC240028

USD 1,240.00

5 Weeks

DHX8 (myc-DDK-tagged) - Human DEAH (Asp-Glu-Ala-His) box polypeptide 8 (DHX8), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
DHX8 (NM_004941) Human Tagged Lenti ORF Clone
RC208403L1

USD 1,836.00

In Stock

Lenti ORF clone of Human DEAH (Asp-Glu-Ala-His) box polypeptide 8 (DHX8), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
DHX8 (NM_004941) Human Untagged Clone
SC117043

USD 310.00

In Stock

DHX8 (untagged)-Human DEAH (Asp-Glu-Ala-His) box polypeptide 8 (DHX8)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
DHX8 (NM_004941) Human Tagged ORF Clone
RC208403L2

USD 1,480.00

3 Weeks

Lenti ORF clone of Human DEAH (Asp-Glu-Ala-His) box polypeptide 8 (DHX8), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
DHX8 (NM_004941) Human Untagged Clone
SC324113

USD 310.00

In Stock

DHX8 (untagged)-Human DEAH (Asp-Glu-Ala-His) box polypeptide 8 (DHX8)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
DHX8 Rabbit Polyclonal Antibody
TA313749

USD 345.00

In Stock

Rabbit polyclonal anti-DHX8 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human DHX8.
DHX8 (NM_004941) Human Over-expression Lysate
LC417642

USD 121.00

In Stock

DHX8 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
DHX8 Rabbit Polyclonal Antibody
TA341575

USD 375.00

5 Days

Rabbit Polyclonal Anti-DHX8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DHX8 antibody: synthetic peptide directed towards the N terminal of human DHX8. Synthetic peptide located within the following region: VKNGAEFTDSLISNLLRLIQTMRPPAKPSTSKDPVVKPKTEKEKLKELFP
DHX8 (NM_004941) Human Mass Spec Standard
PH308403

USD 2,055.00

3 Weeks

DHX8 MS Standard C13 and N15-labeled recombinant protein (NP_004932)

Tag C-Myc/DDK
Expression Host HEK293
DHX8 (NM_001302623) Human Tagged ORF Clone
RG240028

USD 1,280.00

2 Weeks

DHX8 (GFP-tagged) - Human DEAH (Asp-Glu-Ala-His) box polypeptide 8 (DHX8), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
DHX8 (NM_001302623) Human Untagged Clone
SC337922

USD 1,190.00

5 Weeks

DHX8 (untagged) - Human DEAH (Asp-Glu-Ala-His) box polypeptide 8 (DHX8), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
DHX8 ICC Control Block
TB408403

USD 1,930.00

4 Weeks

Transient overexpression of DHX8 (NM_004941) in HEK293T cells paraffin embedded controls for ICC/IHC staining

DHX8 ICC Control Block
TB440028

USD 1,890.00

4 Weeks

Transient overexpression of DHX8 (NM_001302623) in HEK293T cells paraffin embedded controls for ICC/IHC staining

DHX8 Cytosection
TS408403

USD 225.00

4 Weeks

Transient overexpression of DHX8 (NM_004941) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

DHX8 Cytosection
TS408403P5

USD 889.00

4 Weeks

Transient overexpression of DHX8 (NM_004941) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

DHX8 ICC Control Sections
TS440028P5

USD 889.00

4 Weeks

Transient overexpression of DHX8 (NM_001302623) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack