Germany
Japan
United Kingdom
China
DHX8 (Myc-DDK-tagged)-Human DEAH (Asp-Glu-Ala-His) box polypeptide 8 (DHX8)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, DHX8 (Myc-DDK tagged) - Human DEAH (Asp-Glu-Ala-His) box polypeptide 8 (DHX8), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, DHX8 (mGFP-tagged) - Human DEAH (Asp-Glu-Ala-His) box polypeptide 8 (DHX8), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
DHX8 (GFP-tagged) - Human DEAH (Asp-Glu-Ala-His) box polypeptide 8 (DHX8)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Recombinant protein of human DEAH (Asp-Glu-Ala-His) box polypeptide 8 (DHX8)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Dhx8 (Myc-DDK-tagged) - Mouse DEAH (Asp-Glu-Ala-His) box polypeptide 8 (Dhx8)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
DHX8 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN408403 is the updated version of KN208403.
Dhx8 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN504572 is the updated version of KN304572.
Dhx8 (GFP-tagged) - Mouse DEAH (Asp-Glu-Ala-His) box polypeptide 8 (Dhx8), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Dhx8 (Myc-DDK-tagged) - Mouse DEAH (Asp-Glu-Ala-His) box polypeptide 8 (Dhx8)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Dhx8 (Myc-DDK-tagged) - Mouse DEAH (Asp-Glu-Ala-His) box polypeptide 8 (Dhx8), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Dhx8 (mGFP-tagged) - Mouse DEAH (Asp-Glu-Ala-His) box polypeptide 8 (Dhx8)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Dhx8 (GFP-tagged) - Mouse DEAH (Asp-Glu-Ala-His) box polypeptide 8 (Dhx8), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human DEAH (Asp-Glu-Ala-His) box polypeptide 8 (DHX8), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, DHX8 (Myc-DDK tagged) - Human DEAH (Asp-Glu-Ala-His) box polypeptide 8 (DHX8), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human DEAH (Asp-Glu-Ala-His) box polypeptide 8 (DHX8), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, DHX8 (mGFP-tagged) - Human DEAH (Asp-Glu-Ala-His) box polypeptide 8 (DHX8), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
DHX8 (myc-DDK-tagged) - Human DEAH (Asp-Glu-Ala-His) box polypeptide 8 (DHX8), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Dhx8 (Myc-DDK-tagged ORF) - Rat DEAH (Asp-Glu-Ala-His) box polypeptide 8 (Dhx8), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human DEAH (Asp-Glu-Ala-His) box polypeptide 8 (DHX8), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
DHX8 (untagged)-Human DEAH (Asp-Glu-Ala-His) box polypeptide 8 (DHX8)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human DEAH (Asp-Glu-Ala-His) box polypeptide 8 (DHX8), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
DHX8 (untagged)-Human DEAH (Asp-Glu-Ala-His) box polypeptide 8 (DHX8)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit polyclonal anti-DHX8 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human DHX8. |
DHX8 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of DEAH (Asp-Glu-Ala-His) box polypeptide 8 (DHX8)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Rabbit Polyclonal Anti-DHX8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DHX8 antibody: synthetic peptide directed towards the N terminal of human DHX8. Synthetic peptide located within the following region: VKNGAEFTDSLISNLLRLIQTMRPPAKPSTSKDPVVKPKTEKEKLKELFP |
DHX8 CRISPRa kit - CRISPR gene activation of human DEAH-box helicase 8
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Dhx8 CRISPRa kit - CRISPR gene activation of mouse DEAH (Asp-Glu-Ala-His) box polypeptide 8
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene DHX8
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene DHX8
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
Dhx8 (untagged) - Mouse DEAH (Asp-Glu-Ala-His) box polypeptide 8 (Dhx8), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Dhx8
DHX8 MS Standard C13 and N15-labeled recombinant protein (NP_004932)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
DHX8 (GFP-tagged) - Human DEAH (Asp-Glu-Ala-His) box polypeptide 8 (DHX8), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Dhx8 (untagged ORF) - Rat DEAH (Asp-Glu-Ala-His) box polypeptide 8 (Dhx8), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of DEAH (Asp-Glu-Ala-His) box polypeptide 8 (DHX8) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
DHX8 (untagged) - Human DEAH (Asp-Glu-Ala-His) box polypeptide 8 (DHX8), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
DHX8 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Dhx8 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Dhx8 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
DHX8 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human DHX8 |
DHX8 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1001-1220 of human DHX8 (NP_004932.1). |
| Modifications | Unmodified |
Transient overexpression of DHX8 (NM_004941) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of DHX8 (NM_001302623) in HEK293T cells paraffin embedded controls for ICC/IHC staining
DHX8 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
| E. coli Selection | Chloramphenicol |
| Mammalian Cell Selection | Puromycin |
DHX8 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Dhx8 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Dhx8 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Active filters
Target Symbol
- DHX8