Products

cDNA Clones (8)
Proteins (5)
Antibodies (1)
Jump to Filters
View as table Download
LSM8 (NM_016200) Human Tagged ORF Clone
RC205117

USD 98.00

USD 390.00

In Stock

NAA38 (Myc-DDK-tagged)-Human N(alpha)-acetyltransferase 38, NatC auxiliary subunit (NAA38)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
LSM8 (NM_016200) Human Tagged ORF Clone
RC205117L3

USD 620.00

3 Weeks

Lenti-ORF clone of NAA38 (Myc-DDK-tagged)-Human N(alpha)-acetyltransferase 38, NatC auxiliary subunit (NAA38)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
LSM8 (NM_016200) Human Tagged ORF Clone Lentiviral Particle
RC205117L3V

USD 820.00

6 Weeks

Lenti ORF particles, NAA38 (Myc-DDK-tagged)-Human N(alpha)-acetyltransferase 38, NatC auxiliary subunit (NAA38), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
LSM8 (NM_016200) Human Tagged ORF Clone
RC205117L4

USD 620.00

3 Weeks

Lenti-ORF clone of NAA38 (mGFP-tagged)-Human N(alpha)-acetyltransferase 38, NatC auxiliary subunit (NAA38)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
LSM8 (NM_016200) Human Tagged ORF Clone Lentiviral Particle
RC205117L4V

USD 820.00

6 Weeks

Lenti ORF particles, NAA38 (mGFP-tagged)-Human N(alpha)-acetyltransferase 38, NatC auxiliary subunit (NAA38), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
LSM8 (NM_016200) Human Tagged ORF Clone
RG205117

USD 460.00

3 Weeks

NAA38 (GFP-tagged) - Human N(alpha)-acetyltransferase 38, NatC auxiliary subunit (NAA38)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
LSM8 Rabbit Polyclonal Antibody
TA343843

USD 475.00

5 Days

Rabbit Polyclonal Anti-LSM8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LSM8 antibody: synthetic peptide directed towards the N terminal of human LSM8. Synthetic peptide located within the following region: MTSALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHERVFSSSQ
LSM8 (BC002742) Human Untagged Clone
SC126134

USD 310.00

In Stock

LSM8 (untagged)-Human LSM8 homolog, U6 small nuclear RNA associated (S. cerevisiae), mRNA (cDNA clone MGC:3345 IMAGE:3626875), complete cds

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
LSM8 (NM_016200) Human Over-expression Lysate
LC414132

USD 121.00

In Stock

LSM8 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LSM8 (NM_016200) Human Over-expression Lysate
LY414132

USD 396.00

In Stock

Transient overexpression lysate of N(alpha)-acetyltransferase 38, NatC auxiliary subunit (NAA38)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LSM8 (NM_016200) Human Untagged Clone
SC114417

USD 310.00

In Stock

NAA38 (untagged)-Human N(alpha)-acetyltransferase 38, NatC auxiliary subunit (NAA38)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
LSM8 (NM_016200) ICC Control Block
TB405117

USD 1,040.00

4 Weeks

Transient overexpression of LSM8 (NM_016200) in HEK293T cells paraffin embedded controls for ICC/IHC staining

LSM8 Cytosection
TS405117

USD 225.00

4 Weeks

Transient overexpression of LSM8 (NM_016200) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

LSM8 Cytosection
TS405117P5

USD 889.00

4 Weeks

Transient overexpression of LSM8 (NM_016200) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack