Germany
Japan
United Kingdom
China
NAA38 (Myc-DDK-tagged)-Human N(alpha)-acetyltransferase 38, NatC auxiliary subunit (NAA38)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Naa38 (Myc-DDK-tagged) - Mouse N(alpha)-acetyltransferase 38, NatC auxiliary subunit (Naa38)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
NAA38 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN405117 is the updated version of KN205117.
Lsm8 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN509538 is the updated version of KN309538.
Naa38 (GFP-tagged) - Mouse LSM8 homolog, U6 small nuclear RNA associated (S
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Naa38 (Myc-DDK-tagged) - Mouse N(alpha)-acetyltransferase 38, NatC auxiliary subunit (Naa38)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Naa38 (Myc-DDK-tagged) - Mouse N(alpha)-acetyltransferase 38, NatC auxiliary subunit (Naa38), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Naa38 (mGFP-tagged) - Mouse N(alpha)-acetyltransferase 38, NatC auxiliary subunit (Naa38)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Naa38 (GFP-tagged) - Mouse N(alpha)-acetyltransferase 38, NatC auxiliary subunit (Naa38), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of NAA38 (Myc-DDK-tagged)-Human N(alpha)-acetyltransferase 38, NatC auxiliary subunit (NAA38)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, NAA38 (Myc-DDK-tagged)-Human N(alpha)-acetyltransferase 38, NatC auxiliary subunit (NAA38), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of NAA38 (mGFP-tagged)-Human N(alpha)-acetyltransferase 38, NatC auxiliary subunit (NAA38)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, NAA38 (mGFP-tagged)-Human N(alpha)-acetyltransferase 38, NatC auxiliary subunit (NAA38), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
NAA38 (GFP-tagged) - Human N(alpha)-acetyltransferase 38, NatC auxiliary subunit (NAA38)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Naa38 (Myc-DDK-tagged ORF) - Rat LSM8 homolog, U6 small nuclear RNA associated (S. cerevisiae) (Lsm8), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Naa38 (Myc-DDK-tagged ORF) - Rat LSM8 homolog, U6 small nuclear RNA associated (S. cerevisiae) (Lsm8), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Naa38 (Myc-DDK-tagged ORF) - Rat LSM8 homolog, U6 small nuclear RNA associated (S. cerevisiae) (Lsm8), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Naa38 (mGFP-tagged ORF) - Rat LSM8 homolog, U6 small nuclear RNA associated (S. cerevisiae) (Lsm8), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Naa38 (GFP-tagged ORF) - Rat LSM8 homolog, U6 small nuclear RNA associated (S. cerevisiae) (Lsm8), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Rabbit Polyclonal Anti-LSM8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LSM8 antibody: synthetic peptide directed towards the N terminal of human LSM8. Synthetic peptide located within the following region: MTSALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHERVFSSSQ |
LSM8 (untagged)-Human LSM8 homolog, U6 small nuclear RNA associated (S. cerevisiae), mRNA (cDNA clone MGC:3345 IMAGE:3626875), complete cds
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
LSM8 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of N(alpha)-acetyltransferase 38, NatC auxiliary subunit (NAA38)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Naa38 (untagged) - Mouse N(alpha)-acetyltransferase 38, NatC auxiliary subunit (Naa38), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
NAA38 (untagged)-Human N(alpha)-acetyltransferase 38, NatC auxiliary subunit (NAA38)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
LSM8 CRISPRa kit - CRISPR gene activation of human LSM8 homolog, U6 small nuclear RNA associated
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene LSM8
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene LSM8
qPCR primer pairs and template standards against Mus musculus gene Lsm8
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Mus musculus gene Lsm8
AAV ORF Particles, serotype AAV-2, Naa38 (Myc-DDK-tagged) - Mouse N(alpha)-acetyltransferase 38, NatC auxiliary subunit (Naa38), 250ul, >10^13 TU/mL
- AAV ORF®
-
AAV ORF Particles, serotype AAV-2, NAA38 (Myc-DDK-tagged)-Human N(alpha)-acetyltransferase 38, NatC auxiliary subunit (NAA38), 250ul, >10^13 TU/mL
- AAV ORF®
-
Naa38 (untagged ORF) - Rat LSM8 homolog, U6 small nuclear RNA associated (S. cerevisiae) (Lsm8), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
LSM8 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Lsm8 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Lsm8 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
LSM8 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-96 of human LSM8 (NP_057284.1). |
| Modifications | Unmodified |
Transient overexpression of LSM8 (NM_016200) in HEK293T cells paraffin embedded controls for ICC/IHC staining
LSM8 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
LSM8 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Lsm8 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Naa38 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Lsm8 - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Lsm8 - Rat shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
LSM8 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Lsm8 - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vectorr
| Format | Retroviral plasmids |
| Vector | pRS |
Lsm8 - Rat, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Transient overexpression of LSM8 (NM_016200) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of LSM8 (NM_016200) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- LSM8