Products

cDNA Clones (11)
Proteins (7)
Antibodies (1)
Jump to Filters
View as table Download
PHF5A (NM_032758) Human Tagged ORF Clone
RC200284

USD 98.00

USD 390.00

In Stock

PHF5A (Myc-DDK-tagged)-Human PHD finger protein 5A (PHF5A)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PHF5A (NM_032758) Human Tagged ORF Clone Lentiviral Particle
RC200284L1V

USD 1,020.00

2 Weeks

Lenti ORF particles, PHF5A (Myc-DDK tagged) - Human PHD finger protein 5A (PHF5A), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
PHF5A (NM_032758) Human Tagged ORF Clone Lentiviral Particle
RC200284L2V

USD 1,020.00

5 Weeks

Lenti ORF particles, PHF5A (mGFP-tagged) - Human PHD finger protein 5A (PHF5A), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
PHF5A (NM_032758) Human Tagged ORF Clone
RG200284

USD 460.00

In Stock

PHF5A (GFP-tagged) - Human PHD finger protein 5A (PHF5A)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PHF5A (NM_032758) Human Tagged Lenti ORF Clone
RC200284L3

USD 768.00

3 Weeks

Lenti ORF clone of Human PHD finger protein 5A (PHF5A), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PHF5A (NM_032758) Human Tagged Lenti ORF Clone
RC200284L4

USD 768.00

3 Weeks

Lenti ORF clone of Human PHD finger protein 5A (PHF5A), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PHF5A (NM_032758) Human Tagged Lenti ORF Clone
RC200284L1

USD 768.00

In Stock

Lenti ORF clone of Human PHD finger protein 5A (PHF5A), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
PHF5A (NM_032758) Human Untagged Clone
SC123060

USD 310.00

In Stock

PHF5A (untagged)-Human PHD finger protein 5A (PHF5A)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
PHF5A (NM_032758) Human Tagged Lenti ORF Clone
RC200284L2

USD 768.00

3 Weeks

Lenti ORF clone of Human PHD finger protein 5A (PHF5A), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
PHF5A (NM_032758) Human Over-expression Lysate
LY409947

USD 396.00

5 Days

Transient overexpression lysate of PHD finger protein 5A (PHF5A)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PHF5A Rabbit Polyclonal Antibody
TA342483

USD 375.00

5 Days

Rabbit Polyclonal Anti-PHF5A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PHF5A antibody: synthetic peptide directed towards the middle region of human PHF5A. Synthetic peptide located within the following region: ICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKK
PHF5A (1-110, His-tag) Human Protein
AR50991PU-N

USD 845.00

2 Weeks

PHF5A (1-110, His-tag) human protein, 0.1 mg

Tag His-tag
Expression Host E. coli
PHF5A (1-110, His-tag) Human Protein
AR50991PU-S

USD 330.00

2 Weeks

PHF5A (1-110, His-tag) human protein, 20 µg

Tag His-tag
Expression Host E. coli
PHF5A (NM_032758) Human Over-expression Lysate
LC409947

USD 121.00

2 Weeks

PHF5A HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PHF5A (NM_032758) ICC Control Block
TB400284

USD 1,040.00

4 Weeks

Transient overexpression of PHF5A (NM_032758) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PHF5A Cytosection
TS400284

USD 225.00

4 Weeks

Transient overexpression of PHF5A (NM_032758) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

PHF5A Cytosection
TS400284P5

USD 889.00

4 Weeks

Transient overexpression of PHF5A (NM_032758) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack