PHF5A (Myc-DDK-tagged)-Human PHD finger protein 5A (PHF5A)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PHF5A (Myc-DDK-tagged)-Human PHD finger protein 5A (PHF5A)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, PHF5A (Myc-DDK tagged) - Human PHD finger protein 5A (PHF5A), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF particles, PHF5A (mGFP-tagged) - Human PHD finger protein 5A (PHF5A), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
PHF5A (GFP-tagged) - Human PHD finger protein 5A (PHF5A)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human PHD finger protein 5A (PHF5A), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PHF5A (Myc-DDK tagged) - Human PHD finger protein 5A (PHF5A), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human PHD finger protein 5A (PHF5A), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PHF5A (mGFP-tagged) - Human PHD finger protein 5A (PHF5A), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human PHD finger protein 5A (PHF5A), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
PHF5A (untagged)-Human PHD finger protein 5A (PHF5A)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human PHD finger protein 5A (PHF5A), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Transient overexpression lysate of PHD finger protein 5A (PHF5A)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-PHF5A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PHF5A antibody: synthetic peptide directed towards the middle region of human PHF5A. Synthetic peptide located within the following region: ICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKK |
PHF5A (1-110, His-tag) human protein, 0.1 mg
Tag | His-tag |
Expression Host | E. coli |
PHF5A (1-110, His-tag) human protein, 20 µg
Tag | His-tag |
Expression Host | E. coli |
PHF5A HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression of PHF5A (NM_032758) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PHF5A (NM_032758) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PHF5A (NM_032758) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack