PHF5A Rabbit Polyclonal Antibody

CAT#: TA342483

Rabbit Polyclonal Anti-PHF5A Antibody

Product Images

WB Suggested Anti-PHF5A Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: OVCAR-3 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PHF5A antibody: synthetic peptide directed towards the middle region of human PHF5A. Synthetic peptide located within the following region: ICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 12 kDa
• Gene Name: PHD finger protein 5A
• Database Link:
  NP_116147
  Entrez Gene 84844 Human
  UniProt ID Q7RTV0
• Background: This gene encodes a subunit of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence-independent manner and may anchor the U2 snRNP to the pre-mRNA. The protein encoded by this gene contains a PHD-finger-like domain that is flanked by highly basic N- and C-termini. This protein belongs to the PHD-finger superfamily and may act as a chromatin-associated protein. This gene has several pseudogenes on different chromosomes. [provided by RefSeq, Jul 2008]
• Synonyms: bK223H9.2; INI; Rds3; SAP14b; SF3B7; SF3b14b
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transcription Factors
• Protein Pathways: Spliceosome