Products

cDNA Clones (7)
Proteins (3)
Antibodies (1)
Jump to Filters
View as table Download
PRPF38B (NM_018061) Human Tagged ORF Clone
RC223346

USD 420.00

In Stock

PRPF38B (Myc-DDK-tagged)-Human PRP38 pre-mRNA processing factor 38 (yeast) domain containing B (PRPF38B), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PRPF38B (NM_018061) Human Tagged ORF Clone
RC223346L3

USD 620.00

3 Weeks

Lenti-ORF clone of PRPF38B (Myc-DDK-tagged)-Human PRP38 pre-mRNA processing factor 38 (yeast) domain containing B (PRPF38B), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PRPF38B (NM_018061) Human Tagged ORF Clone Lentiviral Particle
RC223346L3V

USD 820.00

6 Weeks

Lenti ORF particles, PRPF38B (Myc-DDK-tagged)-Human PRP38 pre-mRNA processing factor 38 (yeast) domain containing B (PRPF38B), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PRPF38B (NM_018061) Human Tagged ORF Clone
RC223346L4

USD 620.00

3 Weeks

Lenti-ORF clone of PRPF38B (mGFP-tagged)-Human PRP38 pre-mRNA processing factor 38 (yeast) domain containing B (PRPF38B), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PRPF38B (NM_018061) Human Tagged ORF Clone Lentiviral Particle
RC223346L4V

USD 820.00

6 Weeks

Lenti ORF particles, PRPF38B (mGFP-tagged)-Human PRP38 pre-mRNA processing factor 38 (yeast) domain containing B (PRPF38B), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PRPF38B (NM_018061) Human Tagged ORF Clone
RG223346

USD 460.00

3 Weeks

PRPF38B (GFP-tagged) - Human PRP38 pre-mRNA processing factor 38 (yeast) domain containing B (PRPF38B), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PRPF38B Rabbit Polyclonal Antibody
TA331873

USD 375.00

5 Days

Rabbit Polyclonal Anti-PRPF38B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PRPF38B Antibody is: synthetic peptide directed towards the middle region of Human PRPF38B. Synthetic peptide located within the following region: VQLYELKTYHEVVDEIYFKVTHVEPWEKGSRKTAGQTGMCGGVRGVGTGG
PRPF38B (NM_018061) Human Untagged Clone
SC310279

USD 760.00

3 Weeks

PRPF38B (untagged)-Human PRP38 pre-mRNA processing factor 38 (yeast) domain containing B (PRPF38B), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
PRPF38B (NM_018061) ICC Control Block
TB423346

USD 1,070.00

4 Weeks

Transient overexpression of PRPF38B (NM_018061) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PRPF38B Cytosection
TS423346

USD 225.00

4 Weeks

Transient overexpression of PRPF38B (NM_018061) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

PRPF38B Cytosection
TS423346P5

USD 889.00

4 Weeks

Transient overexpression of PRPF38B (NM_018061) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack