Germany
Japan
United Kingdom
China
SNRPA (Myc-DDK-tagged)-Human small nuclear ribonucleoprotein polypeptide A (SNRPA)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human small nuclear ribonucleoprotein polypeptide A (SNRPA)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
SNRPA (GFP-tagged) - Human small nuclear ribonucleoprotein polypeptide A (SNRPA)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human small nuclear ribonucleoprotein polypeptide A (SNRPA), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SNRPA (Myc-DDK tagged) - Human small nuclear ribonucleoprotein polypeptide A (SNRPA), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human small nuclear ribonucleoprotein polypeptide A (SNRPA), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SNRPA (mGFP-tagged) - Human small nuclear ribonucleoprotein polypeptide A (SNRPA), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Rabbit Polyclonal Anti-SNRPA Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SNRPA antibody: synthetic peptide directed towards the middle region of human SNRPA. Synthetic peptide located within the following region: MPGQMPPAQPLSENPPNHILFLTNLPEETNELMLSMLFNQFPGFKEVRLV |
Rabbit Polyclonal Anti-SNRPA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SNRPA antibody: synthetic peptide directed towards the N terminal of human SNRPA. Synthetic peptide located within the following region: MAVPETRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLK |
U1A (SNRPA) (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 82-111 amino acids from the Central region of human SNRPA |
SNRPA (untagged)-Human small nuclear ribonucleoprotein polypeptide A (SNRPA)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression lysate of small nuclear ribonucleoprotein polypeptide A (SNRPA)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
SNRPA HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
SNRPA MS Standard C13 and N15-labeled recombinant protein (NP_004587)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Transient overexpression of SNRPA (NM_004596) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of SNRPA (NM_004596) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of SNRPA (NM_004596) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- SNRPA
Pathways
- Spliceosome