Germany
Japan
United Kingdom
China
SNRPD1 (Myc-DDK-tagged)-Human small nuclear ribonucleoprotein D1 polypeptide 16kDa (SNRPD1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
SNRPD1 (GFP-tagged) - Human small nuclear ribonucleoprotein D1 polypeptide 16kDa (SNRPD1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of SNRPD1 (Myc-DDK-tagged)-Human small nuclear ribonucleoprotein D1 polypeptide 16kDa (SNRPD1)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SNRPD1 (Myc-DDK-tagged)-Human small nuclear ribonucleoprotein D1 polypeptide 16kDa (SNRPD1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of SNRPD1 (mGFP-tagged)-Human small nuclear ribonucleoprotein D1 polypeptide 16kDa (SNRPD1)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SNRPD1 (mGFP-tagged)-Human small nuclear ribonucleoprotein D1 polypeptide 16kDa (SNRPD1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
SNRPD1 (myc-DDK-tagged) - Human small nuclear ribonucleoprotein D1 polypeptide 16kDa (SNRPD1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Rabbit Polyclonal Anti-SNRPD1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SNRPD1 antibody: synthetic peptide directed towards the N terminal of human SNRPD1. Synthetic peptide located within the following region: NGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFIL |
SNRPD1 (untagged)-Human small nuclear ribonucleoprotein D1 polypeptide 16kDa (SNRPD1)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
SNRPD1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of small nuclear ribonucleoprotein D1 polypeptide 16kDa (SNRPD1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
SNRPD1 (GFP-tagged) - Human small nuclear ribonucleoprotein D1 polypeptide 16kDa (SNRPD1), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
SNRPD1 (untagged) - Human small nuclear ribonucleoprotein D1 polypeptide 16kDa (SNRPD1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression of SNRPD1 (NM_006938) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of SNRPD1 (NM_001291916) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of SNRPD1 (NM_006938) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of SNRPD1 (NM_006938) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of SNRPD1 (NM_001291916) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- SNRPD1
Pathways
- Spliceosome