Germany
Japan
United Kingdom
China
THOC1 (Myc-DDK-tagged)-Human THO complex 1 (THOC1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
USD 823.00
In Stock
Recombinant protein of human THO complex 1 (THOC1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
USD 880.00
3 Weeks
Lenti ORF particles, THOC1 (Myc-DDK tagged) - Human THO complex 1 (THOC1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 880.00
6 Weeks
Lenti ORF particles, THOC1 (mGFP-tagged) - Human THO complex 1 (THOC1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Rabbit Polyclonal Anti-THOC1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-THOC1 antibody: synthetic peptide directed towards the C terminal of human THOC1. Synthetic peptide located within the following region: TNQQFKSLQEYLENMVIKLAKELPPPSEEIKTGEDEDEEDNDALLKENES |
THOC1 (GFP-tagged) - Human THO complex 1 (THOC1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human THO complex 1 (THOC1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 880.00
5 Weeks
Lenti ORF particles, THOC1 (Myc-DDK tagged) - Human THO complex 1 (THOC1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human THO complex 1 (THOC1), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 880.00
7 Weeks
Lenti ORF particles, THOC1 (mGFP-tagged) - Human THO complex 1 (THOC1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 840.00
In Stock
Lenti ORF clone of Human THO complex 1 (THOC1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
THOC1 (untagged)-Human THO complex 1 (THOC1)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-THOC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-THOC1 antibody is: synthetic peptide directed towards the C-terminal region of Human THOC1. Synthetic peptide located within the following region: NEQESTLGQKHTEDREEGMDVEEGEMGDEEAPTTCSIPIDYNLYRKFWSL |
Lenti ORF clone of Human THO complex 1 (THOC1), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
USD 121.00
In Stock
THOC1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
USD 512.00
2 Weeks
Rabbit Polyclonal antibody to Nuclear Matrix Protein p84 (THO complex 1)
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 404 of Nuclear Matrix Protein p84 |
USD 396.00
5 Days
Transient overexpression lysate of THO complex 1 (THOC1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
USD 2,055.00
3 Weeks
THOC1 MS Standard C13 and N15-labeled recombinant protein (NP_005122)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Transient overexpression of THOC1 (NM_005131) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of THOC1 (NM_005131) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of THOC1 (NM_005131) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- THOC1
Pathways
- Spliceosome