Products

cDNA Clones (18)
Proteins (16)
Antibodies (2)
Jump to Filters
View as table Download
UGP2 (NM_006759) Human Tagged ORF Clone
RC208376

USD 480.00

In Stock

UGP2 (Myc-DDK-tagged)-Human UDP-glucose pyrophosphorylase 2 (UGP2), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
UGP2 (NM_001001521) Human Tagged ORF Clone
RC200246

USD 98.00

USD 560.00

In Stock

UGP2 (Myc-DDK-tagged)-Human UDP-glucose pyrophosphorylase 2 (UGP2), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
UGP2 (NM_006759) Human Tagged ORF Clone Lentiviral Particle
RC208376L1V

USD 880.00

6 Weeks

Lenti ORF particles, UGP2 (Myc-DDK tagged) - Human UDP-glucose pyrophosphorylase 2 (UGP2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
UGP2 (NM_006759) Human Tagged ORF Clone Lentiviral Particle
RC208376L2V

USD 880.00

6 Weeks

Lenti ORF particles, UGP2 (mGFP-tagged) - Human UDP-glucose pyrophosphorylase 2 (UGP2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
UGP2 (NM_001001521) Human Tagged ORF Clone
RG200246

USD 460.00

In Stock

UGP2 (GFP-tagged) - Human UDP-glucose pyrophosphorylase 2 (UGP2), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
UGP2 (NM_006759) Human Tagged ORF Clone
RG208376

USD 530.00

In Stock

UGP2 (GFP-tagged) - Human UDP-glucose pyrophosphorylase 2 (UGP2), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
UGP2 (NM_001001521) Human Tagged Lenti ORF Clone
RC200246L3

USD 768.00

3 Weeks

Lenti ORF clone of Human UDP-glucose pyrophosphorylase 2 (UGP2), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
UGP2 (NM_001001521) Human Tagged ORF Clone Lentiviral Particle
RC200246L3V

USD 1,020.00

5 Weeks

Lenti ORF particles, UGP2 (Myc-DDK tagged) - Human UDP-glucose pyrophosphorylase 2 (UGP2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
UGP2 (NM_001001521) Human Tagged Lenti ORF Clone
RC200246L4

USD 768.00

3 Weeks

Lenti ORF clone of Human UDP-glucose pyrophosphorylase 2 (UGP2), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
UGP2 (NM_001001521) Human Tagged ORF Clone Lentiviral Particle
RC200246L4V

USD 1,020.00

5 Weeks

Lenti ORF particles, UGP2 (mGFP-tagged) - Human UDP-glucose pyrophosphorylase 2 (UGP2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
UGP2 (NM_006759) Human Tagged ORF Clone
RC208376L3

USD 680.00

3 Weeks

Lenti ORF clone of Human UDP-glucose pyrophosphorylase 2 (UGP2), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
UGP2 (NM_006759) Human Tagged ORF Clone Lentiviral Particle
RC208376L3V

USD 880.00

6 Weeks

Lenti ORF particles, UGP2 (Myc-DDK tagged) - Human UDP-glucose pyrophosphorylase 2 (UGP2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
UGP2 (NM_006759) Human Tagged ORF Clone
RC208376L4

USD 680.00

3 Weeks

Lenti ORF clone of Human UDP-glucose pyrophosphorylase 2 (UGP2), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
UGP2 (NM_006759) Human Tagged ORF Clone Lentiviral Particle
RC208376L4V

USD 880.00

6 Weeks

Lenti ORF particles, UGP2 (mGFP-tagged) - Human UDP-glucose pyrophosphorylase 2 (UGP2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
UGP2 Rabbit Polyclonal Antibody
TA346610

USD 475.00

5 Days

Rabbit Polyclonal Anti-UGP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UGP2 antibody: synthetic peptide directed towards the N terminal of human UGP2. Synthetic peptide located within the following region: TKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDN
UGP2 (NM_006759) Human Tagged ORF Clone
RC208376L1

USD 680.00

3 Weeks

Lenti ORF clone of Human UDP-glucose pyrophosphorylase 2 (UGP2), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
UGP2 (NM_006759) Human Tagged ORF Clone
RC208376L2

USD 680.00

3 Weeks

Lenti ORF clone of Human UDP-glucose pyrophosphorylase 2 (UGP2), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
UGP2 (NM_006759) Human Untagged Clone
SC321821

USD 760.00

In Stock

UGP2 (untagged)-Human UDP-glucose pyrophosphorylase 2 (UGP2), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
UGP2 (1-508, His-tag) Human Protein
AR51685PU-N

USD 1,105.00

2 Weeks

UGP2 (1-508, His-tag) human recombinant protein, 0.25 mg

Tag His-tag
Expression Host E. coli
UGP2 (1-508, His-tag) Human Protein
AR51685PU-S

USD 415.00

2 Weeks

UGP2 (1-508, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli
UGP2 (NM_006759) Human Over-expression Lysate
LC416438

USD 121.00

2 Weeks

UGP2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
UGP2 (NM_001001521) Human Over-expression Lysate
LC424368

USD 121.00

2 Weeks

UGP2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
UGP2 (NM_006759) Human Over-expression Lysate
LY416438

USD 396.00

5 Days

Transient overexpression lysate of UDP-glucose pyrophosphorylase 2 (UGP2), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
UGP2 (NM_001001521) Human Over-expression Lysate
LY424368

USD 396.00

5 Days

Transient overexpression lysate of UDP-glucose pyrophosphorylase 2 (UGP2), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
UGP2 (NM_001001521) Human Mass Spec Standard
PH300246

USD 2,055.00

3 Weeks

UGP2 MS Standard C13 and N15-labeled recombinant protein (NP_001001521)

Tag C-Myc/DDK
Expression Host HEK293
UGP2 (NM_006759) Human Mass Spec Standard
PH308376

USD 2,055.00

3 Weeks

UGP2 MS Standard C13 and N15-labeled recombinant protein (NP_006750)

Tag C-Myc/DDK
Expression Host HEK293
UGP2 (NM_001001521) Human Untagged Clone
SC300205

USD 760.00

3 Weeks

UGP2 (untagged)-Human UDP-glucose pyrophosphorylase 2 (UGP2), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
UGP2 Rabbit Polyclonal Antibody
TA350571

USD 345.00

In Stock

Rabbit Polyclonal Anti-UGP2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human UGP2
UGP2 ICC Control Block
TB400246

USD 1,210.00

4 Weeks

Transient overexpression of UGP2 (NM_001001521) in HEK293T cells paraffin embedded controls for ICC/IHC staining

UGP2 ICC Control Block
TB408376

USD 1,130.00

4 Weeks

Transient overexpression of UGP2 (NM_006759) in HEK293T cells paraffin embedded controls for ICC/IHC staining

UGP2 Cytosection
TS400246

USD 225.00

4 Weeks

Transient overexpression of UGP2 (NM_001001521) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

UGP2 Cytosection
TS400246P5

USD 889.00

4 Weeks

Transient overexpression of UGP2 (NM_001001521) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

UGP2 Cytosection
TS408376

USD 225.00

4 Weeks

Transient overexpression of UGP2 (NM_006759) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

UGP2 Cytosection
TS408376P5

USD 889.00

4 Weeks

Transient overexpression of UGP2 (NM_006759) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack