Products

View as table Download

USD 98.00

USD 390.00

In Stock

CDC42 (Myc-DDK-tagged)-Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

USD 98.00

USD 390.00

In Stock

CDC42 (Myc-DDK-tagged)-Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

CDC42 (Myc-DDK-tagged)-Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

CDC42 (GFP-tagged) - Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF particles, CDC42 (Myc-DDK tagged) - Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, CDC42 (mGFP-tagged) - Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

Lenti ORF particles, CDC42 (Myc-DDK tagged) - Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, CDC42 (mGFP-tagged) - Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

CDC42 (GFP-tagged) - Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

CDC42 (GFP-tagged) - Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF particles, CDC42 (Myc-DDK tagged) - Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CDC42 (mGFP-tagged) - Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CDC42 (Myc-DDK tagged) - Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CDC42 (mGFP-tagged) - Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CDC42 (Myc-DDK tagged) - Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CDC42 (mGFP-tagged) - Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

CDC42 (untagged)-Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Rabbit anti-CDC42 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CDC42

Lenti ORF clone of Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

CDC42 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T

CDC42 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

CDC42 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

CDC42 (untagged)-Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Chicken Polyclonal CDC42 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CDC42 antibody was raised against a 17 amino acid peptide near the amino terminus of human CDC42.

Rabbit polyclonal anti-cdc42/Rac antibody

Applications WB
Reactivities Bovine, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptides surrounding amino acid 144 of human cdc42

Rabbit Polyclonal Anti-CDC42 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDC42 antibody: synthetic peptide directed towards the N terminal of human CDC42. Synthetic peptide located within the following region: DNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSP

CDC42 (1-188, T7-tag) human recombinant protein, 0.5 mg

Tag T7-tag
Expression Host E. coli

CDC42 (1-188, T7-tag) human recombinant protein, 0.1 mg

Tag T7-tag
Expression Host E. coli

CDC42 MS Standard C13 and N15-labeled recombinant protein (NP_001782)

Tag C-Myc/DDK
Expression Host HEK293

CDC42 MS Standard C13 and N15-labeled recombinant protein (NP_426359)

Tag C-Myc/DDK
Expression Host HEK293

CDC42 MS Standard C13 and N15-labeled recombinant protein (NP_001034891)

Tag C-Myc/DDK
Expression Host HEK293

CDC42 (untagged)-Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

Anti-Cdc42/Rho/Rac Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 57-71 amino acids of Human Cell division cycle 42

USD 1,040.00

4 Weeks

Transient overexpression of CDC42 (NM_001791) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 1,040.00

4 Weeks

Transient overexpression of CDC42 (NM_044472) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 1,070.00

4 Weeks

Transient overexpression of CDC42 (NM_001039802) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of CDC42 (NM_001791) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of CDC42 (NM_001791) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack