Products

View as table Download

USD 98.00

USD 390.00

In Stock

IL5 (Myc-DDK-tagged)-Human interleukin 5 (colony-stimulating factor, eosinophil) (IL5)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

IL5 (GFP-tagged) - Human interleukin 5 (colony-stimulating factor, eosinophil) (IL5)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human interleukin 5 (colony-stimulating factor, eosinophil) (IL5), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, IL5 (Myc-DDK tagged) - Human interleukin 5 (colony-stimulating factor, eosinophil) (IL5), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human interleukin 5 (colony-stimulating factor, eosinophil) (IL5), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, IL5 (mGFP-tagged) - Human interleukin 5 (colony-stimulating factor, eosinophil) (IL5), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Purified recombinant protein of Human interleukin 5 (colony-stimulating factor, eosinophil) (IL5).

Tag Tag Free
Expression Host E. coli

IL5 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide, corresponding to amino acids 61-110 of Human IL-5

IL5 (untagged)-Human interleukin 5 (colony-stimulating factor, eosinophil) (IL5)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Anti-Human IL-5 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IL-5

Rabbit Polyclonal Anti-Interleukin 5 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Interleukin 5 Antibody: A synthesized peptide derived from human Interleukin 5

Biotinylated Anti-Human IL-5 Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IL-5

Rabbit Polyclonal Anti-IL5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-IL5 Antibody: synthetic peptide directed towards the middle region of human IL5. Synthetic peptide located within the following region: LESQTVQGGTVERLFKNLSLIKKYIDGQKKKCGEERRRVNQFLDYLQEFL

Mouse Monoclonal Anti-IL-5 Antibody

Reactivities Human, Rhesus Macaque
Conjugation Unconjugated

Mouse Monoclonal Anti-IL-5 Antibody

Reactivities Human
Conjugation Unconjugated

Mouse Monoclonal Anti-IL-5 Antibody

Reactivities Rhesus Macaque, Cynomolgus Monkey, Human
Conjugation Unconjugated

Purified recombinant protein of Human interleukin 5 (colony-stimulating factor, eosinophil) (IL5)

Tag C-His
Expression Host HEK293

IL5 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

USD 1,040.00

4 Weeks

Transient overexpression of IL5 (NM_000879) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Purified recombinant protein of Human interleukin 5 (colony-stimulating factor, eosinophil) (IL5), with C-terminal His tag, secretory expressed in HEK293 cells, 50ug

Tag C-HIS
Expression Host HEK293

Purified recombinant protein of Human interleukin 5 (colony-stimulating factor, eosinophil) (IL5)

Tag C-His
Expression Host HEK293

Purified recombinant protein of Human interleukin 5 (colony-stimulating factor, eosinophil) (IL5)

Tag C-His
Expression Host HEK293

Purified recombinant protein of Human interleukin 5 (colony-stimulating factor, eosinophil) (IL5)

Tag C-His
Expression Host HEK293

USD 225.00

4 Weeks

Transient overexpression of IL5 (NM_000879) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of IL5 (NM_000879) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack