Products

View as table Download

USD 98.00

USD 390.00

In Stock

GNG3 (Myc-DDK-tagged)-Human guanine nucleotide binding protein (G protein), gamma 3 (GNG3)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

GNG3 (GFP-tagged) - Human guanine nucleotide binding protein (G protein), gamma 3 (GNG3)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human guanine nucleotide binding protein (G protein), gamma 3 (GNG3), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, GNG3 (Myc-DDK tagged) - Human guanine nucleotide binding protein (G protein), gamma 3 (GNG3), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human guanine nucleotide binding protein (G protein), gamma 3 (GNG3), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, GNG3 (mGFP-tagged) - Human guanine nucleotide binding protein (G protein), gamma 3 (GNG3), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

GNG3 (untagged)-Human guanine nucleotide binding protein (G protein), gamma 3 (GNG3)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Rabbit Polyclonal Anti-GNG3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GNG3 antibody is: synthetic peptide directed towards the middle region of Human GNG3. Synthetic peptide located within the following region: IEASLCRIKVSKAAADLMTYCDAHACEDPLITPVPTSENPFREKKFFCAL

GNG3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

USD 1,040.00

4 Weeks

Transient overexpression of GNG3 (NM_012202) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of GNG3 (NM_012202) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of GNG3 (NM_012202) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack