GNG3 (Myc-DDK-tagged)-Human guanine nucleotide binding protein (G protein), gamma 3 (GNG3)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GNG3 (Myc-DDK-tagged)-Human guanine nucleotide binding protein (G protein), gamma 3 (GNG3)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GNG3 (GFP-tagged) - Human guanine nucleotide binding protein (G protein), gamma 3 (GNG3)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human guanine nucleotide binding protein (G protein), gamma 3 (GNG3), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GNG3 (Myc-DDK tagged) - Human guanine nucleotide binding protein (G protein), gamma 3 (GNG3), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human guanine nucleotide binding protein (G protein), gamma 3 (GNG3), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GNG3 (mGFP-tagged) - Human guanine nucleotide binding protein (G protein), gamma 3 (GNG3), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
GNG3 (untagged)-Human guanine nucleotide binding protein (G protein), gamma 3 (GNG3)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Transient overexpression lysate of guanine nucleotide binding protein (G protein), gamma 3 (GNG3)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Rabbit Polyclonal Anti-GNG3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GNG3 antibody is: synthetic peptide directed towards the middle region of Human GNG3. Synthetic peptide located within the following region: IEASLCRIKVSKAAADLMTYCDAHACEDPLITPVPTSENPFREKKFFCAL |
GNG3 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression of GNG3 (NM_012202) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GNG3 (NM_012202) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GNG3 (NM_012202) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack