Products

cDNA Clones (10)
Proteins (5)
Antibodies (3)
Jump to Filters
View as table Download
Claudin 23 (CLDN23) (NM_194284) Human Tagged ORF Clone
RC221232

USD 420.00

In Stock

CLDN23 (Myc-DDK-tagged)-Human claudin 23 (CLDN23)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Claudin 23 (CLDN23) (NM_194284) Human Tagged ORF Clone
RG221232

USD 460.00

In Stock

CLDN23 (GFP-tagged) - Human claudin 23 (CLDN23)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Claudin 23 (CLDN23) Rabbit Polyclonal Antibody
TA349284

USD 380.00

In Stock

Rabbit Polyclonal Anti-CLDN23 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CLDN23
Claudin 23 (CLDN23) Rabbit Polyclonal Antibody
TA334206

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-CLDN23 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLDN23 antibody: synthetic peptide directed towards the C terminal of human CLDN23. Synthetic peptide located within the following region: IKYYSDGQHRPPPAQHRKPKPKPKVGFPMPRPRPKAYTNSVDVLDGEGWE
Claudin 23 (CLDN23) (C-term) Rabbit Polyclonal Antibody
AP50948PU-N

USD 450.00

2 Weeks

Claudin 23 (CLDN23) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 235~265 amino acids from the C-terminal region of human CLDN23
Claudin 23 (CLDN23) (NM_194284) Human Tagged ORF Clone
RC221232L1

USD 620.00

3 Weeks

Lenti ORF clone of Human claudin 23 (CLDN23), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Claudin 23 (CLDN23) (NM_194284) Human Untagged Clone
SC317428

USD 660.00

In Stock

CLDN23 (untagged)-Human claudin 23 (CLDN23)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Claudin 23 (CLDN23) (NM_194284) Human Over-expression Lysate
LC405122

USD 121.00

2 Weeks

CLDN23 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Claudin 23 (CLDN23) (NM_194284) ICC Control Block
TB421232

USD 1,070.00

4 Weeks

Transient overexpression of CLDN23 (NM_194284) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Claudin 23 (CLDN23) Cytosection
TS421232

USD 225.00

4 Weeks

Transient overexpression of CLDN23 (NM_194284) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Claudin 23 (CLDN23) Cytosection
TS421232P5

USD 889.00

4 Weeks

Transient overexpression of CLDN23 (NM_194284) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack