Products

View as table Download

ALDH7A1 (Myc-DDK-tagged)-Human aldehyde dehydrogenase 7 family, member A1 (ALDH7A1), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Recombinant protein of human aldehyde dehydrogenase 7 family, member A1 (ALDH7A1)

Tag C-Myc/DDK
Expression Host HEK293T

Lenti ORF particles, ALDH7A1 (Myc-DDK tagged) - Human aldehyde dehydrogenase 7 family, member A1 (ALDH7A1), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF clone of Human aldehyde dehydrogenase 7 family, member A1 (ALDH7A1), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ALDH7A1 (Myc-DDK tagged) - Human aldehyde dehydrogenase 7 family, member A1 (ALDH7A1), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

ALDH7A1 (Myc-DDK tagged) - Homo sapiens aldehyde dehydrogenase 7 family, member A1 (ALDH7A1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

ALDH7A1 (Myc-DDK tagged) - Homo sapiens aldehyde dehydrogenase 7 family, member A1 (ALDH7A1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

ALDH7A1 (GFP-tagged) - Human aldehyde dehydrogenase 7 family, member A1 (ALDH7A1), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

ALDH7A1 (GFP-tagged) - Homo sapiens aldehyde dehydrogenase 7 family, member A1 (ALDH7A1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

ALDH7A1 (GFP-tagged) - Homo sapiens aldehyde dehydrogenase 7 family, member A1 (ALDH7A1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human aldehyde dehydrogenase 7 family, member A1 (ALDH7A1), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

ALDH7A1 (untagged)-Human aldehyde dehydrogenase 7 family, member A1 (ALDH7A1), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Rabbit Polyclonal Anti-ALDH7A1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALDH7A1 antibody: synthetic peptide directed towards the N terminal of human ALDH7A1. Synthetic peptide located within the following region: NQPQYAWLKELGLREENEGVYNGSWGGRGEVITTYCPANNEPIARVRQAS

ALDH7A1 (untagged)-Human aldehyde dehydrogenase 7 family member A1 (ALDH7A1)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

ALDH7A1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T

ALDH7A1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of aldehyde dehydrogenase 7 family, member A1 (ALDH7A1), nuclear gene encoding mitochondrial protein, transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

ALDH7A1 (untagged)-Human aldehyde dehydrogenase 7 family, member A1 (ALDH7A1), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

Carrier-free (BSA/glycerol-free) ALDH7A1 mouse monoclonal antibody,clone OTI10A12

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ALDH7A1 mouse monoclonal antibody,clone OTI1A9

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ALDH7A1 (untagged) - Homo sapiens aldehyde dehydrogenase 7 family, member A1 (ALDH7A1), transcript variant 1

Vector pCMV6 series
Tag Tag Free

ALDH7A1 (untagged) - Homo sapiens aldehyde dehydrogenase 7 family, member A1 (ALDH7A1), transcript variant 2

Vector pCMV6 series
Tag Tag Free

ALDH7A1 mouse monoclonal antibody,clone OTI10A12

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ALDH7A1 mouse monoclonal antibody,clone OTI10A12

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ALDH7A1 mouse monoclonal antibody,clone OTI1A9

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ALDH7A1 mouse monoclonal antibody,clone OTI1A9, Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

ALDH7A1 mouse monoclonal antibody,clone OTI1A9, HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

ALDH7A1 mouse monoclonal antibody,clone OTI1A9

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

USD 1,130.00

4 Weeks

Transient overexpression of ALDH7A1 (NM_001182) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 1,130.00

4 Weeks

Transient overexpression of ALDH7A1 (NM_001202404) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 1,190.00

4 Weeks

Transient overexpression of ALDH7A1 (NM_001201377) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of ALDH7A1 (NM_001182) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of ALDH7A1 (NM_001182) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of ALDH7A1 (NM_001202404) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of ALDH7A1 (NM_001201377) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack