Products

cDNA Clones (11)
Proteins (9)
Antibodies (3)
Jump to Filters
View as table Download
kynurenine 3 monooxygenase (KMO) (NM_003679) Human Tagged ORF Clone
RG222594

USD 500.00

In Stock

KMO (GFP-tagged) - Human kynurenine 3-monooxygenase (kynurenine 3-hydroxylase) (KMO)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
kynurenine 3 monooxygenase (KMO) (NM_003679) Human Tagged ORF Clone Lentiviral Particle
RC222594L3V

USD 850.00

5 Weeks

Lenti ORF particles, KMO (Myc-DDK tagged) - Human kynurenine 3-monooxygenase (kynurenine 3-hydroxylase) (KMO), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
kynurenine 3 monooxygenase (KMO) (NM_003679) Human Tagged ORF Clone Lentiviral Particle
RC222594L4V

USD 850.00

7 Weeks

Lenti ORF particles, KMO (mGFP-tagged) - Human kynurenine 3-monooxygenase (kynurenine 3-hydroxylase) (KMO), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
kynurenine 3 monooxygenase (KMO) (NM_003679) Human Untagged Clone
SC117858

USD 820.00

In Stock

KMO (untagged)-Human kynurenine 3-monooxygenase (kynurenine 3-hydroxylase) (KMO)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
kynurenine 3 monooxygenase (KMO) Rabbit Polyclonal Antibody
TA325062

USD 450.00

2 Weeks

Rabbit polyclonal KMO Antibody (Center)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This KMO antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 155-182 amino acids from the Central region of human KMO.
kynurenine 3 monooxygenase (KMO) (NM_003679) Human Over-expression Lysate
LY401216

USD 605.00

In Stock

Transient overexpression lysate of kynurenine 3-monooxygenase (kynurenine 3-hydroxylase) (KMO)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
kynurenine 3 monooxygenase (KMO) (NM_003679) Human Recombinant Protein
TP710125

USD 425.00

In Stock

Recombinant protein of human kynurenine 3-monooxygenase (kynurenine 3-hydroxylase) (KMO), full length, with C-terminal DDK tag, expressed in sf9, 20ug

Tag C-DDK
Expression Host Sf9
kynurenine 3 monooxygenase (KMO) (NM_003679) Human Tagged ORF Clone
RC222594L2

USD 650.00

3 Weeks

Lenti ORF clone of Human kynurenine 3-monooxygenase (kynurenine 3-hydroxylase) (KMO), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
kynurenine 3 monooxygenase (KMO) Rabbit Polyclonal Antibody
TA343355

USD 375.00

5 Days

Rabbit Polyclonal Anti-KMO Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KMO antibody is: synthetic peptide directed towards the N-terminal region of Human KMO. Synthetic peptide located within the following region: RLLKCNPEEGMITVLGSDKVPKDVTCDLIVGCDGAYSTVRSHLMKKPRFD
kynurenine 3 monooxygenase (KMO) (NM_003679) Human Recombinant Protein
TP700071

USD 748.00

In Stock

Purified protein of Homo sapiens kynurenine 3-monooxygenase (kynurenine 3-hydroxylase) (KMO), with C-terminal AVI tag (GGGLNDIFEAQKIEWHE) prior to MYC/DDK tag, expressed in human cells, 20ug

Tag C-Myc/DDK
Expression Host HEK293
kynurenine 3 monooxygenase (KMO) (NM_003679) Human Recombinant Protein
TP700072

USD 748.00

In Stock

Purified protein of Homo sapiens kynurenine 3-monooxygenase (kynurenine 3-hydroxylase) (KMO), with N-terminal AVI tag (MSGLNDIFEAQKIEWHEAIA) and C-terminal MYC/DDK tag, expressed in human cells, 20ug

Tag C-Myc/DDK
Expression Host HEK293
kynurenine 3 monooxygenase (KMO) (NM_003679) ICC Control Block
TB422594

USD 1,100.00

4 Weeks

Transient overexpression of KMO (NM_003679) in HEK293T cells paraffin embedded controls for ICC/IHC staining

kynurenine 3 monooxygenase (KMO) Cytosection
TS422594

USD 225.00

4 Weeks

Transient overexpression of KMO (NM_003679) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

kynurenine 3 monooxygenase (KMO) Cytosection
TS422594P5

USD 889.00

4 Weeks

Transient overexpression of KMO (NM_003679) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack