Products

Proteins (3)
Antibodies (2)
cDNA Clones (1)
Jump to Filters
View as table Download
Tryptophanyl tRNA synthetase (WARS) Rabbit Polyclonal Antibody
TA332892

USD 275.00

2 Weeks

Rabbit anti-WARS Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human WARS
Tryptophanyl tRNA synthetase (WARS) Rabbit Polyclonal Antibody
TA344288

USD 475.00

5 Days

Rabbit Polyclonal Anti-WARS Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WARS antibody: synthetic peptide directed towards the N terminal of human WARS. Synthetic peptide located within the following region: EIDSAVKMLVSLKMSYKAAAGEDYKADCPPGNPAPTSNHGPDATEAEEDF
Tryptophanyl tRNA synthetase (WARS) (NM_004184) Human Recombinant Protein
TP720622L

USD 1,900.00

3 Weeks

Purified recombinant protein of Human tryptophanyl-tRNA synthetase (WARS), transcript variant 1

Tag N-His
Expression Host E. coli
Tryptophanyl tRNA synthetase (WARS) (NM_004184) Human Recombinant Protein
TP720622M

USD 760.00

3 Weeks

Purified recombinant protein of Human tryptophanyl-tRNA synthetase (WARS), transcript variant 1

Tag N-His
Expression Host E. coli
Tryptophanyl tRNA synthetase (WARS) (NM_004184) Human Recombinant Protein
TP720622XL

USD 2,800.00

3 Weeks

Purified recombinant protein of Human tryptophanyl-tRNA synthetase (WARS), transcript variant 1

Tag N-His
Expression Host E. coli