Products

RNAi (4)
Proteins (3)
Antibodies (2)
Gene Expression (1)
cDNA Clones (1)
Jump to Filters
View as table Download
Tryptophanyl tRNA synthetase (WARS) Rabbit Polyclonal Antibody
TA332892

USD 275.00

2 Weeks

Rabbit anti-WARS Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human WARS
Tryptophanyl tRNA synthetase (WARS) Rabbit Polyclonal Antibody
TA344288

USD 475.00

5 Days

Rabbit Polyclonal Anti-WARS Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WARS antibody: synthetic peptide directed towards the N terminal of human WARS. Synthetic peptide located within the following region: EIDSAVKMLVSLKMSYKAAAGEDYKADCPPGNPAPTSNHGPDATEAEEDF
WARS1 Human siRNA Oligo Duplex (Locus ID 7453)
SR305091

USD 430.00

In Stock

WARS (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

Human Tryptophanyl tRNA synthetase (WARS) activation kit by CRISPRa
GA105135

USD 1,290.00

2 Weeks

WARS CRISPRa kit - CRISPR gene activation of human tryptophanyl-tRNA synthetase

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
WARS Human shRNA Plasmid Kit (Locus ID 7453)
TL300537

USD 815.00

2 Weeks

WARS - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti
E. coli Selection Chloramphenicol
Mammalian Cell Selection Puromycin
Tryptophanyl tRNA synthetase (WARS) (NM_004184) Human Recombinant Protein
TP720622L

USD 1,900.00

3 Weeks

Purified recombinant protein of Human tryptophanyl-tRNA synthetase (WARS), transcript variant 1

Tag N-His
Expression Host E. coli
Tryptophanyl tRNA synthetase (WARS) (NM_004184) Human Recombinant Protein
TP720622M

USD 760.00

3 Weeks

Purified recombinant protein of Human tryptophanyl-tRNA synthetase (WARS), transcript variant 1

Tag N-His
Expression Host E. coli
Tryptophanyl tRNA synthetase (WARS) (NM_004184) Human Recombinant Protein
TP720622XL

USD 2,800.00

3 Weeks

Purified recombinant protein of Human tryptophanyl-tRNA synthetase (WARS), transcript variant 1

Tag N-His
Expression Host E. coli
WARS Human shRNA Plasmid Kit (Locus ID 7453)
TR300537

USD 715.00

2 Weeks

WARS - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS
E. coli Selection Ampicillin
Mammalian Cell Selection Puromycin