Germany
Japan
United Kingdom
China
CUL1 (Myc-DDK-tagged)-Human cullin 1 (CUL1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
USD 1,010.00
3 Weeks
Lenti ORF particles, CUL1 (Myc-DDK tagged) - Human cullin 1 (CUL1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 1,010.00
6 Weeks
Lenti ORF particles, CUL1 (mGFP-tagged) - Human cullin 1 (CUL1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
CUL1 (GFP-tagged) - Human cullin 1 (CUL1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human cullin 1 (CUL1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 1,010.00
5 Weeks
Lenti ORF particles, CUL1 (Myc-DDK tagged) - Human cullin 1 (CUL1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human cullin 1 (CUL1), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 1,010.00
3 Weeks
Lenti ORF particles, CUL1 (mGFP-tagged) - Human cullin 1 (CUL1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Rabbit Polyclonal Anti-Cullin 1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Cullin 1 Antibody: A synthesized peptide derived from human Cullin 1 |
Lenti ORF clone of Human cullin 1 (CUL1), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
CUL1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Cullin 1 (CUL1) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 679-708 amino acids from the C-terminal region of human CUL1 |
Rabbit polyclonal anti-Cul1 antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 766-776 of Human Cul1 (C-terminus) coupled to KLH. |
Rabbit Polyclonal Anti-CUL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CUL1 antibody: synthetic peptide directed towards the C terminal of human CUL1. Synthetic peptide located within the following region: HQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA |
Cullin 1 (1-410, His-tag) human recombinant protein, 0.25 mg
| Tag | His-tag |
| Expression Host | E. coli |
Cullin 1 (1-410, His-tag) human recombinant protein, 50 µg
| Tag | His-tag |
| Expression Host | E. coli |
Transient overexpression lysate of cullin 1 (CUL1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
CUL1 MS Standard C13 and N15-labeled recombinant protein (NP_003583)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Transient overexpression of CUL1 (NM_003592) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CUL1 (NM_003592) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CUL1 (NM_003592) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- CUL1
Pathways
- Ubiquitin mediated proteolysis