UBA6 (Myc-DDK-tagged)-Human ubiquitin-like modifier activating enzyme 6 (UBA6)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
UBA6 (Myc-DDK-tagged)-Human ubiquitin-like modifier activating enzyme 6 (UBA6)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, UBA6 (Myc-DDK tagged) - Human ubiquitin-like modifier activating enzyme 6 (UBA6), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, UBA6 (mGFP-tagged) - Human ubiquitin-like modifier activating enzyme 6 (UBA6), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
UBA6 (GFP-tagged) - Human ubiquitin-like modifier activating enzyme 6 (UBA6)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human ubiquitin-like modifier activating enzyme 6 (UBA6), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, UBA6 (Myc-DDK tagged) - Human ubiquitin-like modifier activating enzyme 6 (UBA6), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human ubiquitin-like modifier activating enzyme 6 (UBA6), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, UBA6 (mGFP-tagged) - Human ubiquitin-like modifier activating enzyme 6 (UBA6), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human ubiquitin-like modifier activating enzyme 6 (UBA6), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human ubiquitin-like modifier activating enzyme 6 (UBA6), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
UBA6 (untagged)-Human ubiquitin-like modifier activating enzyme 6 (UBA6)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
UBE1L2 / FLJ10808 Mouse Monoclonal (1D11) Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
UBA6 (untagged)-Homo sapiens, Similar to hypothetical protein FLJ10808, clone MGC:34280 IMAGE:5172175, complete cds
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal FLJ10808 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A portion of amino acids 775-825 of human UBE1L2 was used as the immunogen for this antibody. |
Rabbit Polyclonal Anti-UBA6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UBA6 antibody: synthetic peptide directed towards the middle region of human UBA6. Synthetic peptide located within the following region: EVIVPHLTESYNSHRDPPEEEIPFCTLKSFPAAIEHTIQWARDKFESSFS |
UBA6 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of ubiquitin-like modifier activating enzyme 6 (UBA6)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
UBA6 MS Standard C13 and N15-labeled recombinant protein (NP_060697)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
UBA6 (untagged)-Human ubiquitin-like modifier activating enzyme 6 (UBA6)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression of UBA6 (NM_018227) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of UBA6 (NM_018227) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of UBA6 (NM_018227) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack