Products

View as table Download

UBA6 (Myc-DDK-tagged)-Human ubiquitin-like modifier activating enzyme 6 (UBA6)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, UBA6 (Myc-DDK tagged) - Human ubiquitin-like modifier activating enzyme 6 (UBA6), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, UBA6 (mGFP-tagged) - Human ubiquitin-like modifier activating enzyme 6 (UBA6), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

UBA6 (GFP-tagged) - Human ubiquitin-like modifier activating enzyme 6 (UBA6)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human ubiquitin-like modifier activating enzyme 6 (UBA6), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, UBA6 (Myc-DDK tagged) - Human ubiquitin-like modifier activating enzyme 6 (UBA6), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human ubiquitin-like modifier activating enzyme 6 (UBA6), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, UBA6 (mGFP-tagged) - Human ubiquitin-like modifier activating enzyme 6 (UBA6), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human ubiquitin-like modifier activating enzyme 6 (UBA6), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human ubiquitin-like modifier activating enzyme 6 (UBA6), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

UBA6 (untagged)-Human ubiquitin-like modifier activating enzyme 6 (UBA6)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

UBE1L2 / FLJ10808 Mouse Monoclonal (1D11) Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated

UBA6 (untagged)-Homo sapiens, Similar to hypothetical protein FLJ10808, clone MGC:34280 IMAGE:5172175, complete cds

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Rabbit Polyclonal FLJ10808 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A portion of amino acids 775-825 of human UBE1L2 was used as the immunogen for this antibody.

Rabbit Polyclonal Anti-UBA6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UBA6 antibody: synthetic peptide directed towards the middle region of human UBA6. Synthetic peptide located within the following region: EVIVPHLTESYNSHRDPPEEEIPFCTLKSFPAAIEHTIQWARDKFESSFS

UBA6 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of ubiquitin-like modifier activating enzyme 6 (UBA6)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

UBA6 MS Standard C13 and N15-labeled recombinant protein (NP_060697)

Tag C-Myc/DDK
Expression Host HEK293

UBA6 (untagged)-Human ubiquitin-like modifier activating enzyme 6 (UBA6)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

Transient overexpression of UBA6 (NM_018227) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of UBA6 (NM_018227) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of UBA6 (NM_018227) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack