Products

cDNA Clones (28)
Proteins (15)
Antibodies (4)
Jump to Filters
View as table Download
PI 3 Kinase p55 gamma (PIK3R3) (NM_003629) Human Tagged ORF Clone
RC202039

USD 420.00

In Stock

PIK3R3 (Myc-DDK-tagged)-Human phosphoinositide-3-kinase, regulatory subunit 3 (gamma) (PIK3R3), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PI 3 Kinase p55 gamma (PIK3R3) (NM_003629) Human Tagged ORF Clone Lentiviral Particle
RC202039L1V

USD 820.00

4 Weeks

Lenti ORF particles, PIK3R3 (Myc-DDK tagged) - Human phosphoinositide-3-kinase, regulatory subunit 3 (gamma) (PIK3R3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
PI 3 Kinase p55 gamma (PIK3R3) (NM_003629) Human Tagged ORF Clone Lentiviral Particle
RC202039L2V

USD 820.00

6 Weeks

Lenti ORF particles, PIK3R3 (mGFP-tagged) - Human phosphoinositide-3-kinase, regulatory subunit 3 (gamma) (PIK3R3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
PI 3 Kinase p55 gamma (PIK3R3) (NM_001114172) Human Tagged ORF Clone Lentiviral Particle
RC225775L1V

USD 820.00

4 Weeks

Lenti ORF particles, PIK3R3 (Myc-DDK tagged) - Human phosphoinositide-3-kinase, regulatory subunit 3 (gamma) (PIK3R3), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
PI 3 Kinase p55 gamma (PIK3R3) (NM_001114172) Human Tagged ORF Clone Lentiviral Particle
RC225775L2V

USD 820.00

6 Weeks

Lenti ORF particles, PIK3R3 (mGFP-tagged) - Human phosphoinositide-3-kinase, regulatory subunit 3 (gamma) (PIK3R3), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
PI 3 Kinase p55 gamma (PIK3R3) (NM_003629) Human Tagged ORF Clone
RG202039

USD 460.00

In Stock

PIK3R3 (GFP-tagged) - Human phosphoinositide-3-kinase, regulatory subunit 3 (gamma) (PIK3R3), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PI 3 Kinase p55 gamma (PIK3R3) (NM_003629) Human Tagged ORF Clone Lentiviral Particle
RC202039L3V

USD 820.00

6 Weeks

Lenti ORF particles, PIK3R3 (Myc-DDK tagged) - Human phosphoinositide-3-kinase, regulatory subunit 3 (gamma) (PIK3R3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PI 3 Kinase p55 gamma (PIK3R3) (NM_003629) Human Tagged ORF Clone
RC202039L4

USD 620.00

3 Weeks

Lenti ORF clone of Human phosphoinositide-3-kinase, regulatory subunit 3 (gamma) (PIK3R3), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PI 3 Kinase p55 gamma (PIK3R3) (NM_003629) Human Tagged ORF Clone Lentiviral Particle
RC202039L4V

USD 820.00

6 Weeks

Lenti ORF particles, PIK3R3 (mGFP-tagged) - Human phosphoinositide-3-kinase, regulatory subunit 3 (gamma) (PIK3R3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PI 3 Kinase p55 gamma (PIK3R3) (NM_001114172) Human Tagged ORF Clone
RC225775L3

USD 620.00

3 Weeks

Lenti ORF clone of Human phosphoinositide-3-kinase, regulatory subunit 3 (gamma) (PIK3R3), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PI 3 Kinase p55 gamma (PIK3R3) (NM_001114172) Human Tagged ORF Clone Lentiviral Particle
RC225775L3V

USD 820.00

6 Weeks

Lenti ORF particles, PIK3R3 (Myc-DDK tagged) - Human phosphoinositide-3-kinase, regulatory subunit 3 (gamma) (PIK3R3), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PI 3 Kinase p55 gamma (PIK3R3) (NM_001114172) Human Tagged ORF Clone Lentiviral Particle
RC225775L4V

USD 820.00

6 Weeks

Lenti ORF particles, PIK3R3 (mGFP-tagged) - Human phosphoinositide-3-kinase, regulatory subunit 3 (gamma) (PIK3R3), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PIK3R3 (NM_001303429) Human Tagged ORF Clone
RC237997

USD 420.00

2 Weeks

PIK3R3 (myc-DDK-tagged) - Human phosphoinositide-3-kinase, regulatory subunit 3 (gamma) (PIK3R3), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PI 3 Kinase p55 gamma (PIK3R3) (NM_001303428) Human Tagged ORF Clone
RC238464

USD 420.00

2 Weeks

PIK3R3 (myc-DDK-tagged) - Human phosphoinositide-3-kinase, regulatory subunit 3 (gamma) (PIK3R3), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PI 3 Kinase p55 gamma (PIK3R3) (NM_001114172) Human Tagged ORF Clone
RG225775

USD 460.00

3 Weeks

PIK3R3 (GFP-tagged) - Human phosphoinositide-3-kinase, regulatory subunit 3 (gamma) (PIK3R3), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PI 3 Kinase p55 gamma (PIK3R3) (NM_003629) Human Tagged ORF Clone
RC202039L1

USD 768.00

In Stock

Lenti ORF clone of Human phosphoinositide-3-kinase, regulatory subunit 3 (gamma) (PIK3R3), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
PI 3 Kinase p55 gamma (PIK3R3) (NM_001114172) Human Tagged ORF Clone
RC225775L1

USD 768.00

In Stock

Lenti ORF clone of Human phosphoinositide-3-kinase, regulatory subunit 3 (gamma) (PIK3R3), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
PI 3 Kinase p55 gamma (PIK3R3) (NM_003629) Human Over-expression Lysate
LY401202

USD 396.00

5 Days

Transient overexpression lysate of phosphoinositide-3-kinase, regulatory subunit 3 (gamma) (PIK3R3), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PI 3 Kinase p55 gamma (PIK3R3) Rabbit Polyclonal Antibody
TA308969

USD 415.00

In Stock

Rabbit Polyclonal antibody to PIK3R3 (phosphoinositide-3-kinase, regulatory subunit 3 (gamma))

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 192 and 427 of PIK3R3
PI 3 Kinase p55 gamma (PIK3R3) (NM_003629) Human Tagged ORF Clone
RC202039L2

USD 620.00

3 Weeks

Lenti ORF clone of Human phosphoinositide-3-kinase, regulatory subunit 3 (gamma) (PIK3R3), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
PI 3 Kinase p55 gamma (PIK3R3) (NM_001114172) Human Tagged ORF Clone
RC225775L2

USD 620.00

3 Weeks

Lenti ORF clone of Human phosphoinositide-3-kinase, regulatory subunit 3 (gamma) (PIK3R3), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
PI 3 Kinase p55 gamma (PIK3R3) (NM_001114172) Human Over-expression Lysate
LC426469

USD 121.00

In Stock

PIK3R3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PI 3 Kinase p55 gamma (PIK3R3) (NM_003629) Human Untagged Clone
SC108470

USD 760.00

In Stock

PIK3R3 (untagged)-Human phosphoinositide-3-kinase, regulatory subunit 3 (gamma) (PIK3R3), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
PI 3 Kinase p55 gamma (PIK3R3) Rabbit Polyclonal Antibody
TA330913

USD 375.00

5 Days

Rabbit Polyclonal Anti-PIK3R3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PIK3R3 antibody is: synthetic peptide directed towards the C-terminal region of Human PIK3R3. Synthetic peptide located within the following region: DAVGKKLQEYHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIK
PI 3 Kinase p55 gamma (PIK3R3) Rabbit Polyclonal Antibody
TA333991

USD 310.00

5 Days

Rabbit Polyclonal Anti-PIK3R3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PIK3R3 Antibody: synthetic peptide directed towards the middle region of human PIK3R3. Synthetic peptide located within the following region: EYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKEYIERFRREGNE
PI 3 Kinase p55 gamma (PIK3R3) (NM_001114172) Human Over-expression Lysate
LY426469

USD 396.00

5 Days

Transient overexpression lysate of phosphoinositide-3-kinase, regulatory subunit 3 (gamma) (PIK3R3), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PI 3 Kinase p55 gamma (PIK3R3) (NM_001303429) Human Tagged ORF Clone
RG237997

USD 460.00

2 Weeks

PIK3R3 (GFP-tagged) - Human phosphoinositide-3-kinase, regulatory subunit 3 (gamma) (PIK3R3), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PI 3 Kinase p55 gamma (PIK3R3) (NM_001303428) Human Tagged ORF Clone
RG238464

USD 460.00

2 Weeks

PIK3R3 (GFP-tagged) - Human phosphoinositide-3-kinase, regulatory subunit 3 (gamma) (PIK3R3), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PI 3 Kinase p55 gamma (PIK3R3) (NM_001114172) Human Untagged Clone
SC318892

USD 670.00

3 Weeks

PIK3R3 (untagged)-Human phosphoinositide-3-kinase, regulatory subunit 3 (gamma) (PIK3R3), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
PI 3 Kinase p55 gamma (PIK3R3) (NM_001303429) Human Untagged Clone
SC335891

USD 400.00

2 Weeks

PIK3R3 (untagged) - Human phosphoinositide-3-kinase, regulatory subunit 3 (gamma) (PIK3R3), transcript variant 5

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
PI 3 Kinase p55 gamma (PIK3R3) (NM_001303428) Human Untagged Clone
SC336358

USD 480.00

2 Weeks

PIK3R3 (untagged) - Human phosphoinositide-3-kinase, regulatory subunit 3 (gamma) (PIK3R3), transcript variant 4

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
PI 3 Kinase p55 gamma (PIK3R3) Rabbit Polyclonal Antibody
TA350915

USD 345.00

In Stock

Rabbit Polyclonal Anti-PIK3R3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PIK3R3
PI 3 Kinase p55 gamma (PIK3R3) (NM_003629) ICC Control Block
TB402039

USD 1,070.00

4 Weeks

Transient overexpression of PIK3R3 (NM_003629) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PI 3 Kinase p55 gamma (PIK3R3) (NM_001114172) ICC Control Block
TB425775

USD 1,070.00

4 Weeks

Transient overexpression of PIK3R3 (NM_001114172) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PI 3 Kinase p55 gamma (PIK3R3) (NM_001303429) ICC Control Block
TB437997

USD 1,070.00

4 Weeks

Transient overexpression of PIK3R3 (NM_001303429) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PI 3 Kinase p55 gamma (PIK3R3) (NM_001303428) ICC Control Block
TB438464

USD 1,070.00

4 Weeks

Transient overexpression of PIK3R3 (NM_001303428) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PI 3 Kinase p55 gamma (PIK3R3) Cytosection
TS402039

USD 225.00

4 Weeks

Transient overexpression of PIK3R3 (NM_003629) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

PI 3 Kinase p55 gamma (PIK3R3) Cytosection
TS402039P5

USD 889.00

4 Weeks

Transient overexpression of PIK3R3 (NM_003629) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

PI 3 Kinase p55 gamma (PIK3R3) Cytosection
TS425775

USD 225.00

4 Weeks

Transient overexpression of PIK3R3 (NM_001114172) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

PI 3 Kinase p55 gamma (PIK3R3) Cytosection
TS425775P5

USD 889.00

4 Weeks

Transient overexpression of PIK3R3 (NM_001114172) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

PI 3 Kinase p55 gamma (PIK3R3) ICC Control Sections
TS437997P5

USD 889.00

4 Weeks

Transient overexpression of PIK3R3 (NM_001303429) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

PI 3 Kinase p55 gamma (PIK3R3) ICC Control Sections
TS438464P5

USD 889.00

4 Weeks

Transient overexpression of PIK3R3 (NM_001303428) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack