Products

cDNA Clones (14)
Proteins (10)
Antibodies (3)
Jump to Filters
View as table Download
Isoleucyl tRNA synthetase (IARS) (NM_013417) Human Tagged ORF Clone
RG213208

USD 1,460.00

In Stock

IARS (GFP-tagged) - Human isoleucyl-tRNA synthetase (IARS), transcript variant long

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Isoleucyl tRNA synthetase (IARS) (NM_002161) Human Tagged ORF Clone Lentiviral Particle
RC212911L3V

USD 1,730.00

6 Weeks

Lenti ORF particles, IARS (Myc-DDK tagged) - Human isoleucyl-tRNA synthetase (IARS), transcript variant short, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Isoleucyl tRNA synthetase (IARS) (NM_002161) Human Tagged ORF Clone Lentiviral Particle
RC212911L4V

USD 1,730.00

6 Weeks

Lenti ORF particles, IARS (mGFP-tagged) - Human isoleucyl-tRNA synthetase (IARS), transcript variant short, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Isoleucyl tRNA synthetase (IARS) (NM_013417) Human Tagged ORF Clone Lentiviral Particle
RC213208L3V

USD 1,730.00

6 Weeks

Lenti ORF particles, IARS (Myc-DDK tagged) - Human isoleucyl-tRNA synthetase (IARS), transcript variant long, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Isoleucyl tRNA synthetase (IARS) (NM_013417) Human Tagged ORF Clone Lentiviral Particle
RC213208L4V

USD 1,730.00

6 Weeks

Lenti ORF particles, IARS (mGFP-tagged) - Human isoleucyl-tRNA synthetase (IARS), transcript variant long, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Isoleucyl tRNA synthetase (IARS) (NM_002161) Human Tagged ORF Clone
RG212911

USD 1,460.00

3 Weeks

IARS (GFP-tagged) - Human isoleucyl-tRNA synthetase (IARS), transcript variant short

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Isoleucyl tRNA synthetase (IARS) (NM_013417) Human Over-expression Lysate
LY415595

USD 605.00

In Stock

Transient overexpression lysate of isoleucyl-tRNA synthetase (IARS), transcript variant long

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Isoleucyl tRNA synthetase (IARS) (NM_013417) Human Untagged Clone
SC115260

USD 2,550.00

In Stock

IARS (untagged)-Human isoleucyl-tRNA synthetase (IARS), transcript variant long

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
Isoleucyl tRNA synthetase (IARS) (NM_002161) Human Untagged Clone
SC126589

USD 2,550.00

In Stock

IARS (untagged)-Human isoleucyl-tRNA synthetase (IARS), transcript variant short

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
Isoleucyl tRNA synthetase (IARS) Rabbit Polyclonal Antibody
TA334484

USD 375.00

5 Days

Rabbit Polyclonal Anti-IARS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IARS antibody: synthetic peptide directed towards the N terminal of human IARS. Synthetic peptide located within the following region: SKHKPKFTFYDGPPFATGLPHYGHILAGTIKDIVTRYAHQSGFHVDRRFG
Isoleucyl tRNA synthetase (IARS) Rabbit Polyclonal Antibody
TA334485

USD 375.00

5 Days

Rabbit Polyclonal Anti-IARS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IARS antibody: synthetic peptide directed towards the middle region of human IARS. Synthetic peptide located within the following region: YEAAKVFGLRSRKLKLFLNETQTQEITEDIPVKTLNMKTVYVSVLPTTAD
Isoleucyl tRNA synthetase (IARS) Rabbit Polyclonal Antibody
TA334503

USD 375.00

5 Days

Rabbit Polyclonal Anti-ITPK1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ITPK1 antibody: synthetic peptide directed towards the middle region of human ITPK1. Synthetic peptide located within the following region: NAIQPPCVVQNFINHNAVLYKVFVVGESYTVVQRPSLKNFSAGTSDRESI
Isoleucyl tRNA synthetase (IARS) (NM_013417) Human Over-expression Lysate
LC415595

USD 187.00

2 Weeks

IARS HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Isoleucyl tRNA synthetase (IARS) (NM_002161) Human Over-expression Lysate
LC419497

USD 187.00

2 Weeks

IARS HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Isoleucyl tRNA synthetase (IARS) (NM_002161) Human Over-expression Lysate
LY419497

USD 605.00

5 Days

Transient overexpression lysate of isoleucyl-tRNA synthetase (IARS), transcript variant short

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Isoleucyl tRNA synthetase (IARS) ICC Control Block
TB412911

USD 1,980.00

4 Weeks

Transient overexpression of IARS (NM_002161) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Isoleucyl tRNA synthetase (IARS) ICC Control Block
TB413208

USD 1,980.00

4 Weeks

Transient overexpression of IARS (NM_013417) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Isoleucyl tRNA synthetase (IARS) Cytosection
TS412911

USD 225.00

4 Weeks

Transient overexpression of IARS (NM_002161) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Isoleucyl tRNA synthetase (IARS) Cytosection
TS412911P5

USD 889.00

4 Weeks

Transient overexpression of IARS (NM_002161) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Isoleucyl tRNA synthetase (IARS) Cytosection
TS413208

USD 225.00

4 Weeks

Transient overexpression of IARS (NM_013417) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Isoleucyl tRNA synthetase (IARS) Cytosection
TS413208P5

USD 889.00

4 Weeks

Transient overexpression of IARS (NM_013417) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack