Germany
Japan
United Kingdom
China
IARS (Myc-DDK-tagged)-Human isoleucyl-tRNA synthetase (IARS), transcript variant short
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
IARS (Myc-DDK-tagged)-Human isoleucyl-tRNA synthetase (IARS), transcript variant long
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Iars (Myc-DDK-tagged) - Mouse isoleucine-tRNA synthetase (Iars)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
IARS (GFP-tagged) - Human isoleucyl-tRNA synthetase (IARS), transcript variant long
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Iars - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN508062 is the updated version of KN308062.
Iars (GFP-tagged) - Mouse isoleucine-tRNA synthetase (Iars)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Iars (Myc-DDK-tagged) - Mouse isoleucine-tRNA synthetase (Iars)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Iars (Myc-DDK-tagged) - Mouse isoleucine-tRNA synthetase (Iars), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Iars (mGFP-tagged) - Mouse isoleucine-tRNA synthetase (Iars)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Iars (GFP-tagged) - Mouse isoleucine-tRNA synthetase (Iars), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human isoleucyl-tRNA synthetase (IARS), transcript variant short, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 1,730.00
6 Weeks
Lenti ORF particles, IARS (Myc-DDK tagged) - Human isoleucyl-tRNA synthetase (IARS), transcript variant short, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human isoleucyl-tRNA synthetase (IARS), transcript variant short, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 1,730.00
6 Weeks
Lenti ORF particles, IARS (mGFP-tagged) - Human isoleucyl-tRNA synthetase (IARS), transcript variant short, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human isoleucyl-tRNA synthetase (IARS), transcript variant long, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 1,730.00
6 Weeks
Lenti ORF particles, IARS (Myc-DDK tagged) - Human isoleucyl-tRNA synthetase (IARS), transcript variant long, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human isoleucyl-tRNA synthetase (IARS), transcript variant long, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 1,730.00
6 Weeks
Lenti ORF particles, IARS (mGFP-tagged) - Human isoleucyl-tRNA synthetase (IARS), transcript variant long, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
IARS (GFP-tagged) - Human isoleucyl-tRNA synthetase (IARS), transcript variant short
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Iars (Myc-DDK-tagged ORF) - Rat isoleucyl-tRNA synthetase (Iars), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Iars (untagged) - Mouse isoleucine-tRNA synthetase (Iars), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
USD 605.00
In Stock
Transient overexpression lysate of isoleucyl-tRNA synthetase (IARS), transcript variant long
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
IARS (untagged)-Human isoleucyl-tRNA synthetase (IARS), transcript variant long
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
IARS (untagged)-Human isoleucyl-tRNA synthetase (IARS), transcript variant short
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-IARS Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IARS antibody: synthetic peptide directed towards the N terminal of human IARS. Synthetic peptide located within the following region: SKHKPKFTFYDGPPFATGLPHYGHILAGTIKDIVTRYAHQSGFHVDRRFG |
Rabbit Polyclonal Anti-IARS Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IARS antibody: synthetic peptide directed towards the middle region of human IARS. Synthetic peptide located within the following region: YEAAKVFGLRSRKLKLFLNETQTQEITEDIPVKTLNMKTVYVSVLPTTAD |
Rabbit Polyclonal Anti-ITPK1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ITPK1 antibody: synthetic peptide directed towards the middle region of human ITPK1. Synthetic peptide located within the following region: NAIQPPCVVQNFINHNAVLYKVFVVGESYTVVQRPSLKNFSAGTSDRESI |
Iars CRISPRa kit - CRISPR gene activation of mouse isoleucine-tRNA synthetase
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qSTAR qPCR primer pairs against Homo sapiens gene IARS
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
USD 187.00
2 Weeks
IARS HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
USD 187.00
2 Weeks
IARS HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
USD 605.00
5 Days
Transient overexpression lysate of isoleucyl-tRNA synthetase (IARS), transcript variant short
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
qPCR primer pairs and template standards against Mus musculus gene Iars
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Mus musculus gene Iars
Iars (untagged ORF) - Rat isoleucyl-tRNA synthetase (Iars), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of isoleucyl-tRNA synthetase (IARS) transcript variant long for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
3`UTR clone of isoleucyl-tRNA synthetase (IARS) transcript variant short for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
Iars (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
IARS Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1158-1262 of human IARS (NP_002152.2). |
| Modifications | Unmodified |
Transient overexpression of IARS (NM_002161) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of IARS (NM_013417) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Iars - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Iars - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Iars - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Iars - Rat shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Iars - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Iars - Rat, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Transient overexpression of IARS (NM_002161) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of IARS (NM_002161) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of IARS (NM_013417) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Active filters
Target Symbol
- IARS