IL4I1 (Myc-DDK-tagged)-Human interleukin 4 induced 1 (IL4I1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
IL4I1 (Myc-DDK-tagged)-Human interleukin 4 induced 1 (IL4I1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
IL4I1 (Myc-DDK-tagged)-Human interleukin 4 induced 1 (IL4I1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, IL4I1 (Myc-DDK tagged) - Human interleukin 4 induced 1 (IL4I1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, IL4I1 (mGFP-tagged) - Human interleukin 4 induced 1 (IL4I1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
IL4I1 (GFP-tagged) - Human interleukin 4 induced 1 (IL4I1), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
IL4I1 (Myc-DDK tagged) - Homo sapiens interleukin 4 induced 1 (IL4I1), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
IL4I1 (Myc-DDK tagged) - Homo sapiens interleukin 4 induced 1 (IL4I1), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of IL4I1 (Myc-DDK-tagged)-Human interleukin 4 induced 1 (IL4I1), transcript variant 1
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, IL4I1 (Myc-DDK-tagged)-Human interleukin 4 induced 1 (IL4I1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of IL4I1 (mGFP-tagged)-Human interleukin 4 induced 1 (IL4I1), transcript variant 1
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, IL4I1 (mGFP-tagged)-Human interleukin 4 induced 1 (IL4I1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human interleukin 4 induced 1 (IL4I1), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, IL4I1 (Myc-DDK tagged) - Human interleukin 4 induced 1 (IL4I1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human interleukin 4 induced 1 (IL4I1), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, IL4I1 (mGFP-tagged) - Human interleukin 4 induced 1 (IL4I1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
IL4I1 (GFP-tagged) - Human interleukin 4 induced 1 (IL4I1), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
IL4I1 (GFP-tagged) - Homo sapiens interleukin 4 induced 1 (IL4I1), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
IL4I1 (GFP-tagged) - Homo sapiens interleukin 4 induced 1 (IL4I1), transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human interleukin 4 induced 1 (IL4I1), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Transient overexpression lysate of interleukin 4 induced 1 (IL4I1), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human interleukin 4 induced 1 (IL4I1), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit polyclonal anti-IL4I1 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human IL4I1. |
IL4I1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
IL4I1 (untagged)-Human interleukin 4 induced 1 (IL4I1), transcript variant 1
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-IL4I1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-IL4I1 antibody is: synthetic peptide directed towards the C-terminal region of Human IL4I1. Synthetic peptide located within the following region: PHGWVETAVKSALRAAIKINSRKGPASDTASPEGHASDMEGQGHVHGVAS |
IL4I1 MS Standard C13 and N15-labeled recombinant protein (NP_758962)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
IL4I1 (untagged)-Human interleukin 4 induced 1 (IL4I1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
IL4I1 (untagged) - Homo sapiens interleukin 4 induced 1 (IL4I1), transcript variant 3
Vector | pCMV6 series |
Tag | Tag Free |
IL4I1 (untagged) - Homo sapiens interleukin 4 induced 1 (IL4I1), transcript variant 4
Vector | pCMV6 series |
Tag | Tag Free |
Transient overexpression of IL4I1 (NM_152899) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of IL4I1 (NM_172374) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of IL4I1 (NM_001258017) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of IL4I1 (NM_001258018) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Purified recombinant protein of Human interleukin 4 induced 1 (IL4I1), Gln22-End, with C-terminal His tag, secretory expressed in HEK293 cells, 50 ug
Tag | C-HIS |
Expression Host | HEK293 |
Transient overexpression of IL4I1 (NM_152899) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of IL4I1 (NM_152899) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of IL4I1 (NM_172374) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of IL4I1 (NM_172374) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of IL4I1 (NM_001258017) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of IL4I1 (NM_001258017) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of IL4I1 (NM_001258018) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of IL4I1 (NM_001258018) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack