GNA12 (Myc-DDK-tagged)-Human guanine nucleotide binding protein (G protein) alpha 12 (GNA12)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GNA12 (Myc-DDK-tagged)-Human guanine nucleotide binding protein (G protein) alpha 12 (GNA12)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 820.00
3 Weeks
Lenti ORF particles, GNA12 (Myc-DDK tagged) - Human guanine nucleotide binding protein (G protein) alpha 12 (GNA12), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
3 Weeks
Lenti ORF particles, GNA12 (mGFP-tagged) - Human guanine nucleotide binding protein (G protein) alpha 12 (GNA12), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF clone of Human guanine nucleotide binding protein (G protein) alpha 12 (GNA12), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
5 Weeks
Lenti ORF particles, GNA12 (Myc-DDK tagged) - Human guanine nucleotide binding protein (G protein) alpha 12 (GNA12), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human guanine nucleotide binding protein (G protein) alpha 12 (GNA12), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
3 Weeks
Lenti ORF particles, GNA12 (mGFP-tagged) - Human guanine nucleotide binding protein (G protein) alpha 12 (GNA12), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
GNA12 (myc-DDK-tagged) - Human guanine nucleotide binding protein (G protein) alpha 12 (GNA12), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GNA12 (myc-DDK-tagged) - Human guanine nucleotide binding protein (G protein) alpha 12 (GNA12), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GNA12 (myc-DDK-tagged) - Human guanine nucleotide binding protein (G protein) alpha 12 (GNA12), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GNA12 (GFP-tagged) - Human guanine nucleotide binding protein (G protein) alpha 12 (GNA12)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
GNA12 (untagged)-Human guanine nucleotide binding protein (G protein) alpha 12 (GNA12)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-GNA12 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GNA12 antibody: synthetic peptide directed towards the middle region of human GNA12. Synthetic peptide located within the following region: TFQLYVPALSALWRDSGIREAFSRRSEFQLGESVKYFLDNLDRIGQLNYF |
Rabbit Polyclonal Anti-GNA12 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GNA12 antibody is: synthetic peptide directed towards the C-terminal region of Human GNA12. Synthetic peptide located within the following region: PDFRGDPHRLEDVQRYLVQCFDRKRRNRSKPLFHHFTTAIDTENVRFVFH |
GNA12 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of guanine nucleotide binding protein (G protein) alpha 12 (GNA12)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
GNA12 (GFP-tagged) - Human guanine nucleotide binding protein (G protein) alpha 12 (GNA12), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
GNA12 (GFP-tagged) - Human guanine nucleotide binding protein (G protein) alpha 12 (GNA12), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
GNA12 (GFP-tagged) - Human guanine nucleotide binding protein (G protein) alpha 12 (GNA12), transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
GNA12 (untagged) - Human guanine nucleotide binding protein (G protein) alpha 12 (GNA12), transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
GNA12 (untagged) - Human guanine nucleotide binding protein (G protein) alpha 12 (GNA12), transcript variant 3
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
GNA12 (untagged) - Human guanine nucleotide binding protein (G protein) alpha 12 (GNA12), transcript variant 4
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression of GNA12 (NM_007353) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GNA12 (NM_001282440) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GNA12 (NM_001282441) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GNA12 (NM_001293092) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GNA12 (NM_007353) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GNA12 (NM_007353) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of GNA12 (NM_001282440) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of GNA12 (NM_001282441) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of GNA12 (NM_001293092) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack