Products

cDNA Clones (17)
Proteins (7)
Antibodies (2)
Jump to Filters
View as table Download
ATP6V0B (NM_001039457) Human Tagged ORF Clone
RC201396

USD 98.00

USD 390.00

In Stock

ATP6V0B (Myc-DDK-tagged)-Human ATPase, H+ transporting, lysosomal 21kDa, V0 subunit b (ATP6V0B), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ATP6V0B (NM_001039457) Human Tagged ORF Clone
RG201396

USD 460.00

In Stock

ATP6V0B (GFP-tagged) - Human ATPase, H+ transporting, lysosomal 21kDa, V0 subunit b (ATP6V0B), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ATP6V0B (NM_001039457) Human Tagged ORF Clone
RC201396L3

USD 620.00

3 Weeks

Lenti ORF clone of Human ATPase, H+ transporting, lysosomal 21kDa, V0 subunit b (ATP6V0B), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ATP6V0B (NM_001039457) Human Tagged ORF Clone Lentiviral Particle
RC201396L3V

USD 820.00

6 Weeks

Lenti ORF particles, ATP6V0B (Myc-DDK tagged) - Human ATPase, H+ transporting, lysosomal 21kDa, V0 subunit b (ATP6V0B), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ATP6V0B (NM_001039457) Human Tagged ORF Clone
RC201396L4

USD 620.00

3 Weeks

Lenti ORF clone of Human ATPase, H+ transporting, lysosomal 21kDa, V0 subunit b (ATP6V0B), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ATP6V0B (NM_001039457) Human Tagged ORF Clone Lentiviral Particle
RC201396L4V

USD 820.00

6 Weeks

Lenti ORF particles, ATP6V0B (mGFP-tagged) - Human ATPase, H+ transporting, lysosomal 21kDa, V0 subunit b (ATP6V0B), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ATP6V0B (NM_004047) Human Tagged ORF Clone
RC221823

USD 420.00

3 Weeks

ATP6V0B (Myc-DDK-tagged)-Human ATPase, H+ transporting, lysosomal 21kDa, V0 subunit b (ATP6V0B), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ATP6V0B (NM_004047) Human Tagged ORF Clone
RC221823L3

USD 620.00

3 Weeks

Lenti-ORF clone of ATP6V0B (Myc-DDK-tagged)-Human ATPase, H+ transporting, lysosomal 21kDa, V0 subunit b (ATP6V0B), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ATP6V0B (NM_004047) Human Tagged ORF Clone Lentiviral Particle
RC221823L3V

USD 820.00

6 Weeks

Lenti ORF particles, ATP6V0B (Myc-DDK-tagged)-Human ATPase, H+ transporting, lysosomal 21kDa, V0 subunit b (ATP6V0B), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ATP6V0B (NM_004047) Human Tagged ORF Clone
RC221823L4

USD 620.00

3 Weeks

Lenti-ORF clone of ATP6V0B (mGFP-tagged)-Human ATPase, H+ transporting, lysosomal 21kDa, V0 subunit b (ATP6V0B), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ATP6V0B (NM_004047) Human Tagged ORF Clone Lentiviral Particle
RC221823L4V

USD 820.00

6 Weeks

Lenti ORF particles, ATP6V0B (mGFP-tagged)-Human ATPase, H+ transporting, lysosomal 21kDa, V0 subunit b (ATP6V0B), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ATP6V0B (NM_001294333) Human Tagged ORF Clone
RC237004

USD 420.00

2 Weeks

ATP6V0B (myc-DDK-tagged) - Human ATPase, H+ transporting, lysosomal 21kDa, V0 subunit b (ATP6V0B), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ATP6V0B (NM_004047) Human Tagged ORF Clone
RG221823

USD 460.00

4 Weeks

ATP6V0B (GFP-tagged) - Human ATPase, H+ transporting, lysosomal 21kDa, V0 subunit b (ATP6V0B), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ATP6V0B (NM_004047) Human Untagged Clone
SC117630

USD 310.00

In Stock

ATP6V0B (untagged)-Human ATPase, H+ transporting, lysosomal 21kDa, V0 subunit b (ATP6V0B), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
ATP6V0B (Center) Rabbit Polyclonal Antibody
AP50303PU-N

USD 450.00

2 Weeks

ATP6V0B (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 111-139 amino acids from the Central region of human ATP6V0B
ATP6V0B (NM_001039457) Human Untagged Clone
SC324389

USD 420.00

In Stock

ATP6V0B (untagged)-Human ATPase, H+ transporting, lysosomal 21kDa, V0 subunit b (ATP6V0B), transcript variant 2

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
ATP6V0B Rabbit Polyclonal Antibody
TA335996

USD 375.00

5 Days

Rabbit Polyclonal Anti-Atp6v0b Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Atp6v0b Antibody is: synthetic peptide directed towards the N-terminal region of Rat Atp6v0b. Synthetic peptide located within the following region: PSNNLFCPSQPFSATDPKAIGHRNYHAGYSMFGAGLTVGLSNLFCGVCVG
ATP6V0B (NM_001294333) Human Tagged ORF Clone
RG237004

USD 460.00

2 Weeks

ATP6V0B (GFP-tagged) - Human ATPase, H+ transporting, lysosomal 21kDa, V0 subunit b (ATP6V0B), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ATP6V0B (NM_001294333) Human Untagged Clone
SC334898

USD 477.00

2 Weeks

ATP6V0B (untagged) - Human ATPase, H+ transporting, lysosomal 21kDa, V0 subunit b (ATP6V0B), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
ATP6V0B (NM_001039457) ICC Control Block
TB401396

USD 1,040.00

4 Weeks

Transient overexpression of ATP6V0B (NM_001039457) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ATP6V0B (NM_004047) ICC Control Block
TB421823

USD 1,070.00

4 Weeks

Transient overexpression of ATP6V0B (NM_004047) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ATP6V0B (NM_001294333) ICC Control Block
TB437004

USD 1,070.00

4 Weeks

Transient overexpression of ATP6V0B (NM_001294333) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ATP6V0B Cytosection
TS401396

USD 225.00

4 Weeks

Transient overexpression of ATP6V0B (NM_001039457) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

ATP6V0B Cytosection
TS401396P5

USD 889.00

4 Weeks

Transient overexpression of ATP6V0B (NM_001039457) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

ATP6V0B ICC Control Sections
TS421823P5

USD 889.00

4 Weeks

Transient overexpression of ATP6V0B (NM_004047) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

ATP6V0B ICC Control Sections
TS437004P5

USD 889.00

4 Weeks

Transient overexpression of ATP6V0B (NM_001294333) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack