Products

cDNA Clones (24)
Proteins (13)
Antibodies (2)
Jump to Filters
View as table Download
HLAF (HLA-F) (NM_001098479) Human Tagged ORF Clone
RC212120

USD 420.00

In Stock

HLA (Myc-DDK-tagged)-Human major histocompatibility complex, class I, F (HLA-F), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
HLAF (HLA-F) (NM_018950) Human Tagged ORF Clone
RC217084

USD 420.00

In Stock

HLA (Myc-DDK-tagged)-Human major histocompatibility complex, class I, F (HLA-F), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
HLAF (HLA-F) (NM_001098478) Human Tagged ORF Clone
RC213005

USD 98.00

USD 390.00

In Stock

HLA (Myc-DDK-tagged)-Human major histocompatibility complex, class I, F (HLA-F), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
HLAF (HLA-F) (NM_018950) Human Tagged ORF Clone
RG217084

USD 460.00

In Stock

HLA (GFP-tagged) - Human major histocompatibility complex, class I, F (HLA-F), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
HLAF (HLA-F) (NM_001098479) Human Tagged ORF Clone
RC212120L3

USD 620.00

3 Weeks

Lenti-ORF clone of HLA (Myc-DDK-tagged)-Human major histocompatibility complex, class I, F (HLA-F), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
HLAF (HLA-F) (NM_001098479) Human Tagged ORF Clone Lentiviral Particle
RC212120L3V

USD 820.00

7 Weeks

Lenti ORF particles, HLA (Myc-DDK-tagged)-Human major histocompatibility complex, class I, F (HLA-F), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
HLAF (HLA-F) (NM_001098479) Human Tagged ORF Clone
RC212120L4

USD 620.00

3 Weeks

Lenti-ORF clone of HLA (mGFP-tagged)-Human major histocompatibility complex, class I, F (HLA-F), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
HLAF (HLA-F) (NM_001098479) Human Tagged ORF Clone Lentiviral Particle
RC212120L4V

USD 820.00

7 Weeks

Lenti ORF particles, HLA (mGFP-tagged)-Human major histocompatibility complex, class I, F (HLA-F), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
HLAF (HLA-F) (NM_001098478) Human Tagged ORF Clone
RC213005L3

USD 620.00

3 Weeks

Lenti-ORF clone of HLA (Myc-DDK-tagged)-Human major histocompatibility complex, class I, F (HLA-F), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
HLAF (HLA-F) (NM_001098478) Human Tagged ORF Clone Lentiviral Particle
RC213005L3V

USD 820.00

6 Weeks

Lenti ORF particles, HLA (Myc-DDK-tagged)-Human major histocompatibility complex, class I, F (HLA-F), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
HLAF (HLA-F) (NM_001098478) Human Tagged ORF Clone
RC213005L4

USD 620.00

3 Weeks

Lenti-ORF clone of HLA (mGFP-tagged)-Human major histocompatibility complex, class I, F (HLA-F), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
HLAF (HLA-F) (NM_001098478) Human Tagged ORF Clone Lentiviral Particle
RC213005L4V

USD 820.00

6 Weeks

Lenti ORF particles, HLA (mGFP-tagged)-Human major histocompatibility complex, class I, F (HLA-F), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
HLAF (HLA-F) (NM_018950) Human Tagged ORF Clone
RC217084L3

USD 620.00

3 Weeks

Lenti-ORF clone of HLA (Myc-DDK-tagged)-Human major histocompatibility complex, class I, F (HLA-F), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
HLAF (HLA-F) (NM_018950) Human Tagged ORF Clone Lentiviral Particle
RC217084L3V

USD 820.00

6 Weeks

Lenti ORF particles, HLA (Myc-DDK-tagged)-Human major histocompatibility complex, class I, F (HLA-F), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
HLAF (HLA-F) (NM_018950) Human Tagged ORF Clone
RC217084L4

USD 620.00

3 Weeks

Lenti-ORF clone of HLA (mGFP-tagged)-Human major histocompatibility complex, class I, F (HLA-F), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
HLAF (HLA-F) (NM_018950) Human Tagged ORF Clone Lentiviral Particle
RC217084L4V

USD 820.00

6 Weeks

Lenti ORF particles, HLA (mGFP-tagged)-Human major histocompatibility complex, class I, F (HLA-F), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
HLAF (HLA-F) (NM_001098479) Human Tagged ORF Clone
RG212120

USD 460.00

3 Weeks

HLA (GFP-tagged) - Human major histocompatibility complex, class I, F (HLA-F), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
HLAF (HLA-F) (NM_001098478) Human Tagged ORF Clone
RG213005

USD 460.00

3 Weeks

HLA (GFP-tagged) - Human major histocompatibility complex, class I, F (HLA-F), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
HLAF (HLA-F) (NM_001098479) Human Over-expression Lysate
LY420587

USD 605.00

In Stock

Transient overexpression lysate of major histocompatibility complex, class I, F (HLA-F), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
HLAF (HLA-F) (NM_001098479) Human Tagged ORF Clone
RC212120L2

USD 620.00

3 Weeks

Lenti-ORF clone of HLA (mGFP-tagged)-Human major histocompatibility complex, class I, F (HLA-F), transcript variant 1

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
HLAF (HLA-F) Rabbit Polyclonal Antibody
TA331071

USD 375.00

5 Days

Rabbit polyclonal Anti-HLA-F Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HLA-F antibody: synthetic peptide directed towards the N terminal of human HLA-F. Synthetic peptide located within the following region: EAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADT
HLAF (HLA-F) (NM_018950) Human Untagged Clone
SC127080

USD 590.00

In Stock

HLA (untagged)-Human major histocompatibility complex, class I, F (HLA-F), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
HLAF (HLA-F) Rabbit Polyclonal Antibody
TA331070

USD 375.00

5 Days

Rabbit polyclonal Anti-HLA-F Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HLA-F antibody: synthetic peptide directed towards the N terminal of human HLA-F. Synthetic peptide located within the following region: PWVEQEGPQYWEWTTGYAKANAQTDRVALRNLLRRYNQSEAGSHTLQGMN
HLA class I alpha F / HLA-F (22-305, His-tag) Human Protein
AR51552PU-N

USD 845.00

2 Weeks

HLA class I alpha F / HLA-F (22-305, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
HLA class I alpha F / HLA-F (22-305, His-tag) Human Protein
AR51552PU-S

USD 330.00

2 Weeks

HLA class I alpha F / HLA-F (22-305, His-tag) human recombinant protein, 20 µg

Tag His-tag
Expression Host E. coli
HLAF (HLA-F) (NM_001098479) Human Over-expression Lysate
LC420587

USD 187.00

4 Weeks

HLA HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
HLAF (HLA-F) (NM_001098478) Human Untagged Clone
SC316351

USD 420.00

3 Weeks

HLA (untagged)-Human major histocompatibility complex, class I, F (HLA-F), transcript variant 3

Vector pCMV6 series
Tag Tag Free
HLAF (HLA-F) (NM_001098479) Human Untagged Clone
SC316374

USD 740.00

3 Weeks

HLA (untagged)-Human major histocompatibility complex, class I, F (HLA-F), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
HLAF (HLA-F) ICC Control Block
TB412120

USD 1,070.00

4 Weeks

Transient overexpression of HLA (NM_001098479) in HEK293T cells paraffin embedded controls for ICC/IHC staining

HLAF (HLA-F) ICC Control Block
TB413005

USD 1,040.00

4 Weeks

Transient overexpression of HLA (NM_001098478) in HEK293T cells paraffin embedded controls for ICC/IHC staining

HLAF (HLA-F) ICC Control Block
TB417084

USD 1,070.00

4 Weeks

Transient overexpression of HLA-F (NM_018950) in HEK293T cells paraffin embedded controls for ICC/IHC staining

HLAF (HLA-F) Cytosection
TS412120

USD 225.00

4 Weeks

Transient overexpression of HLA (NM_001098479) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

HLAF (HLA-F) Cytosection
TS412120P5

USD 889.00

4 Weeks

Transient overexpression of HLA (NM_001098479) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

HLAF (HLA-F) Cytosection
TS413005

USD 225.00

4 Weeks

Transient overexpression of HLA (NM_001098478) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

HLAF (HLA-F) Cytosection
TS413005P5

USD 889.00

4 Weeks

Transient overexpression of HLA (NM_001098478) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

HLAF (HLA-F) Cytosection
TS417084

USD 225.00

4 Weeks

Transient overexpression of HLA-F (NM_018950) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

HLAF (HLA-F) Cytosection
TS417084P5

USD 889.00

4 Weeks

Transient overexpression of HLA-F (NM_018950) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack