Products

cDNA Clones (10)
Proteins (5)
Antibodies (4)
Jump to Filters
View as table Download
Frizzled 5 (FZD5) (NM_003468) Human Tagged ORF Clone
RC213960

USD 540.00

In Stock

FZD5 (Myc-DDK-tagged)-Human frizzled family receptor 5 (FZD5)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Frizzled 5 (FZD5) (NM_003468) Human Tagged ORF Clone
RG213960

USD 590.00

In Stock

FZD5 (GFP-tagged) - Human frizzled family receptor 5 (FZD5)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Frizzled 5 (FZD5) (NM_003468) Human Tagged ORF Clone
RC213960L4

USD 740.00

3 Weeks

Lenti ORF clone of Human frizzled family receptor 5 (FZD5), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Frizzled 5 (FZD5) (NM_003468) Human Untagged Clone
SC117952

USD 1,000.00

In Stock

FZD5 (untagged)-Human frizzled family receptor 5 (FZD5)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
Frizzled 5 (FZD5) Rabbit Polyclonal Antibody
TA311714

USD 345.00

In Stock

Rabbit polyclonal anti-FZD5 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FZD5.
Frizzled 5 (FZD5) Rabbit Polyclonal Antibody
TA344062

USD 475.00

5 Days

Rabbit Polyclonal Anti-FZD5 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FZD5 antibody: synthetic peptide directed towards the middle region of human FZD5. Synthetic peptide located within the following region: CYLYEQHYRESWEAALTCACPGHDTGQPRAKPEYWVLMLKYFMCLVVGIT
Frizzled 5 (FZD5) Rabbit Polyclonal Antibody
TA344063

USD 475.00

5 Days

Rabbit Polyclonal Anti-FZD5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FZD5 antibody: synthetic peptide directed towards the C terminal of human FZD5. Synthetic peptide located within the following region: SRCCCRPRRGHKSGGAMAAGDYPEASAALTGRTGPPGPAATYHKQVSLSH
Frizzled 5 (FZD5) (NM_003468) Human Over-expression Lysate
LC401175

USD 187.00

In Stock

FZD5 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Frizzled 5 (FZD5) Rabbit Polyclonal Antibody
TA314704

USD 345.00

4 Weeks

Rabbit polyclonal anti-FZD5 antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FZD5.
Frizzled 5 (FZD5) (NM_003468) Human Over-expression Lysate
LY401175

USD 605.00

5 Days

Transient overexpression lysate of frizzled homolog 5 (Drosophila) (FZD5)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Frizzled 5 (FZD5) (NM_003468) ICC Control Block
TB413960

USD 1,190.00

4 Weeks

Transient overexpression of FZD5 (NM_003468) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Frizzled 5 (FZD5) Cytosection
TS413960

USD 225.00

4 Weeks

Transient overexpression of FZD5 (NM_003468) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Frizzled 5 (FZD5) Cytosection
TS413960P5

USD 889.00

4 Weeks

Transient overexpression of FZD5 (NM_003468) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack