Products

cDNA Clones (14)
Proteins (8)
Antibodies (2)
Jump to Filters
View as table Download
NKD2 (NM_033120) Human Tagged ORF Clone
RC214631

USD 420.00

In Stock

NKD2 (Myc-DDK-tagged)-Human naked cuticle homolog 2 (Drosophila) (NKD2)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
NKD2 (NM_033120) Human Tagged ORF Clone Lentiviral Particle
RC214631L1V

USD 820.00

3 Weeks

Lenti ORF particles, NKD2 (Myc-DDK tagged) - Human naked cuticle homolog 2 (Drosophila) (NKD2), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
NKD2 (NM_033120) Human Tagged ORF Clone Lentiviral Particle
RC214631L2V

USD 820.00

6 Weeks

Lenti ORF particles, NKD2 (mGFP-tagged) - Human naked cuticle homolog 2 (Drosophila) (NKD2), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
NKD2 (NM_033120) Human Tagged ORF Clone
RC214631L3

USD 620.00

3 Weeks

Lenti ORF clone of Human naked cuticle homolog 2 (Drosophila) (NKD2), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NKD2 (NM_033120) Human Tagged ORF Clone Lentiviral Particle
RC214631L3V

USD 820.00

7 Weeks

Lenti ORF particles, NKD2 (Myc-DDK tagged) - Human naked cuticle homolog 2 (Drosophila) (NKD2), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NKD2 (NM_033120) Human Tagged ORF Clone
RC214631L4

USD 620.00

3 Weeks

Lenti ORF clone of Human naked cuticle homolog 2 (Drosophila) (NKD2), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NKD2 (NM_033120) Human Tagged ORF Clone Lentiviral Particle
RC214631L4V

USD 820.00

7 Weeks

Lenti ORF particles, NKD2 (mGFP-tagged) - Human naked cuticle homolog 2 (Drosophila) (NKD2), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NKD2 (NM_001271082) Human Tagged ORF Clone
RC232453

USD 420.00

3 Weeks

NKD2 (Myc-DDK tagged) - Homo sapiens naked cuticle homolog 2 (Drosophila) (NKD2), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
NKD2 (NM_033120) Human Tagged ORF Clone
RG214631

USD 460.00

3 Weeks

NKD2 (GFP-tagged) - Human naked cuticle homolog 2 (Drosophila) (NKD2)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
NKD2 (NM_001271082) Human Tagged ORF Clone
RG232453

USD 460.00

3 Weeks

NKD2 (GFP-tagged) - Homo sapiens naked cuticle homolog 2 (Drosophila) (NKD2), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
NKD2 (NM_033120) Human Tagged ORF Clone
RC214631L1

USD 768.00

In Stock

Lenti ORF clone of Human naked cuticle homolog 2 (Drosophila) (NKD2), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
NKD2 Rabbit Polyclonal Antibody
TA344088

USD 475.00

2 Weeks

Rabbit Polyclonal Anti-NKD2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NKD2 antibody: synthetic peptide directed towards the N terminal of human NKD2. Synthetic peptide located within the following region: ARDKQELPNGDPKEGPFREDQCPLQVALPAEKAEGREHPGQLLSADDGER
NKD2 (C-term) Rabbit Polyclonal Antibody
AP52886PU-N

USD 450.00

2 Weeks

NKD2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IF, IHC, WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 373-401aa) of human NKD2
NKD2 (NM_033120) Human Tagged ORF Clone
RC214631L2

USD 620.00

3 Weeks

Lenti ORF clone of Human naked cuticle homolog 2 (Drosophila) (NKD2), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
NKD2 (NM_001271082) Human Untagged Clone
SC330922

USD 320.00

In Stock

NKD2 (untagged) - Homo sapiens naked cuticle homolog 2 (Drosophila) (NKD2), transcript variant 2

Vector PCMV6-Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
NKD2 (NM_033120) Human Recombinant Protein
TP761006

USD 215.00

In Stock

Purified recombinant protein of Human naked cuticle homolog 2 (Drosophila) (NKD2), full length, with N-terminal HIS tag, expressed in E.coli, 50ug

Tag N-His
Expression Host E. coli
NKD2 (NM_033120) Human Untagged Clone
SC313535

USD 760.00

5 Days

NKD2 (untagged)-Human naked cuticle homolog 2 (Drosophila) (NKD2)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
NKD2 (NM_033120) Human Over-expression Lysate
LC409725

USD 187.00

2 Weeks

NKD2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
NKD2 (NM_033120) Human Over-expression Lysate
LY409725

USD 605.00

5 Days

Transient overexpression lysate of naked cuticle homolog 2 (Drosophila) (NKD2)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
NKD2 (NM_033120) ICC Control Block
TB414631

USD 1,070.00

4 Weeks

Transient overexpression of NKD2 (NM_033120) in HEK293T cells paraffin embedded controls for ICC/IHC staining

NKD2 (NM_001271082) ICC Control Block
TB432453

USD 1,070.00

4 Weeks

Transient overexpression of NKD2 (NM_001271082) in HEK293T cells paraffin embedded controls for ICC/IHC staining

NKD2 Cytosection
TS414631

USD 225.00

4 Weeks

Transient overexpression of NKD2 (NM_033120) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

NKD2 Cytosection
TS414631P5

USD 889.00

4 Weeks

Transient overexpression of NKD2 (NM_033120) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

NKD2 ICC Control Sections
TS432453P5

USD 889.00

4 Weeks

Transient overexpression of NKD2 (NM_001271082) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack