Germany
Japan
United Kingdom
China
Lenti ORF particles, PPP2R5A (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B', alpha (PPP2R5A), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Products
View as table DownloadLenti ORF particles, PPP2R5A (mGFP-tagged)-Human protein phosphatase 2, regulatory subunit B', alpha (PPP2R5A), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
PPP2R5A (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B', alpha (PPP2R5A), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of PPP2R5A (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B', alpha (PPP2R5A), transcript variant 1
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PPP2R5A (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B', alpha (PPP2R5A), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of PPP2R5A (mGFP-tagged)-Human protein phosphatase 2, regulatory subunit B', alpha (PPP2R5A), transcript variant 1
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PPP2R5A (mGFP-tagged)-Human protein phosphatase 2, regulatory subunit B', alpha (PPP2R5A), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
PPP2R5A (Myc-DDK tagged) - Homo sapiens protein phosphatase 2, regulatory subunit B', alpha (PPP2R5A), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PPP2R5A (GFP-tagged) - Human protein phosphatase 2, regulatory subunit B', alpha (PPP2R5A), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PPP2R5A (GFP-tagged) - Homo sapiens protein phosphatase 2, regulatory subunit B', alpha (PPP2R5A), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PPP2R5A (untagged)-Human protein phosphatase 2, regulatory subunit B', alpha (PPP2R5A), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
SC116240 is the updated version of SC127989.
Lenti-ORF clone of PPP2R5A (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B', alpha (PPP2R5A), transcript variant 1
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Anti-PPP2R5A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPP2R5A antibody: synthetic peptide directed towards the N terminal of human PPP2R5A. Synthetic peptide located within the following region: YVSTNRGVIVESAYSDIVKMISANIFRTLPPSDNPDFDPEEDEPTLEASW |
Lenti-ORF clone of PPP2R5A (mGFP-tagged)-Human protein phosphatase 2, regulatory subunit B', alpha (PPP2R5A), transcript variant 1
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit polyclonal anti-PPP2R5A antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PPP2R5A. |
PPP2R5A (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 417-446 amino acids from the C-terminal region of human PPP2R5A |
Goat Polyclonal Antibody against PPP2R5A
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-AYNMHSILSNTSAE, from the C Terminus of the protein sequence according to NP_006234.1. |
PPP2R5A (untagged) - Homo sapiens protein phosphatase 2, regulatory subunit B', alpha (PPP2R5A), transcript variant 2
| Vector | pCMV6 series |
| Tag | Tag Free |
Transient overexpression of PPP2R5A (NM_006243) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PPP2R5A (NM_001199756) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PPP2R5A (NM_006243) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PPP2R5A (NM_006243) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of PPP2R5A (NM_001199756) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- PPP2R5A
Pathways
- Wnt signaling pathway