Products

View as table Download

MLST8 (Myc-DDK-tagged)-Human MTOR associated protein, LST8 homolog (S. cerevisiae) (MLST8), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, MLST8 (Myc-DDK tagged) - Human MTOR associated protein, LST8 homolog (S. cerevisiae) (MLST8), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, MLST8 (mGFP-tagged) - Human MTOR associated protein, LST8 homolog (S. cerevisiae) (MLST8), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

MLST8 (Myc-DDK tagged) - Homo sapiens MTOR associated protein, LST8 homolog (S. cerevisiae) (MLST8), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

MLST8 (Myc-DDK tagged) - Homo sapiens MTOR associated protein, LST8 homolog (S. cerevisiae) (MLST8), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

MLST8 (GFP-tagged) - Human MTOR associated protein, LST8 homolog (S. cerevisiae) (MLST8), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human MTOR associated protein, LST8 homolog (S. cerevisiae) (MLST8), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, MLST8 (Myc-DDK tagged) - Human MTOR associated protein, LST8 homolog (S. cerevisiae) (MLST8), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, MLST8 (mGFP-tagged) - Human MTOR associated protein, LST8 homolog (S. cerevisiae) (MLST8), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

MLST8 (Myc-DDK tagged) - Homo sapiens MTOR associated protein, LST8 homolog (S. cerevisiae) (MLST8), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

MLST8 (GFP-tagged) - Homo sapiens MTOR associated protein, LST8 homolog (S. cerevisiae) (MLST8), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

MLST8 (GFP-tagged) - Homo sapiens MTOR associated protein, LST8 homolog (S. cerevisiae) (MLST8), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

MLST8 (GFP-tagged) - Homo sapiens MTOR associated protein, LST8 homolog (S. cerevisiae) (MLST8), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human MTOR associated protein, LST8 homolog (S. cerevisiae) (MLST8), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Rabbit Polyclonal Antibody against GBL (Center)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This GBL antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 140-170 amino acids from the Central region of human GBL.

MLST8 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human MLST8

Rabbit Polyclonal Anti-GBL Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GBL antibody: synthetic peptide directed towards the middle region of human GBL. Synthetic peptide located within the following region: CAFSGDSQYIVTASSDNLARLWCVETGEIKREYGGHQKAVVCLAFNDSVL

Lenti ORF clone of Human MTOR associated protein, LST8 homolog (S. cerevisiae) (MLST8), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

MLST8 (untagged)-Human MTOR associated protein, LST8 homolog (S. cerevisiae) (MLST8), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Rabbit Polyclonal GBL Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen GbL antibody was raised against a 14 amino acid peptide from near the carboxy-terminus of human GbL.

Anti-MLST8 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Transient overexpression lysate of MTOR associated protein, LST8 homolog (S. cerevisiae) (MLST8)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression of MLST8 (NM_022372) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of MLST8 (NM_001199175) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of MLST8 (NM_001199173) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of MLST8 (NM_001199174) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of MLST8 (NM_022372) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of MLST8 (NM_022372) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of MLST8 (NM_001199175) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of MLST8 (NM_001199173) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of MLST8 (NM_001199173) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of MLST8 (NM_001199174) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of MLST8 (NM_001199174) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack