MLST8 (Myc-DDK-tagged)-Human MTOR associated protein, LST8 homolog (S. cerevisiae) (MLST8), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
MLST8 (Myc-DDK-tagged)-Human MTOR associated protein, LST8 homolog (S. cerevisiae) (MLST8), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 820.00
3 Weeks
Lenti ORF particles, MLST8 (Myc-DDK tagged) - Human MTOR associated protein, LST8 homolog (S. cerevisiae) (MLST8), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, MLST8 (mGFP-tagged) - Human MTOR associated protein, LST8 homolog (S. cerevisiae) (MLST8), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
USD 420.00
In Stock
MLST8 (Myc-DDK tagged) - Homo sapiens MTOR associated protein, LST8 homolog (S. cerevisiae) (MLST8), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 420.00
In Stock
MLST8 (Myc-DDK tagged) - Homo sapiens MTOR associated protein, LST8 homolog (S. cerevisiae) (MLST8), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
MLST8 (GFP-tagged) - Human MTOR associated protein, LST8 homolog (S. cerevisiae) (MLST8), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
USD 620.00
3 Weeks
Lenti ORF clone of Human MTOR associated protein, LST8 homolog (S. cerevisiae) (MLST8), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
5 Weeks
Lenti ORF particles, MLST8 (Myc-DDK tagged) - Human MTOR associated protein, LST8 homolog (S. cerevisiae) (MLST8), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 620.00
3 Weeks
Lenti ORF clone of Human MTOR associated protein, LST8 homolog (S. cerevisiae) (MLST8), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
7 Weeks
Lenti ORF particles, MLST8 (mGFP-tagged) - Human MTOR associated protein, LST8 homolog (S. cerevisiae) (MLST8), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 420.00
3 Weeks
MLST8 (Myc-DDK tagged) - Homo sapiens MTOR associated protein, LST8 homolog (S. cerevisiae) (MLST8), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 460.00
3 Weeks
MLST8 (GFP-tagged) - Homo sapiens MTOR associated protein, LST8 homolog (S. cerevisiae) (MLST8), transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
USD 460.00
3 Weeks
MLST8 (GFP-tagged) - Homo sapiens MTOR associated protein, LST8 homolog (S. cerevisiae) (MLST8), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
USD 460.00
3 Weeks
MLST8 (GFP-tagged) - Homo sapiens MTOR associated protein, LST8 homolog (S. cerevisiae) (MLST8), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
USD 768.00
In Stock
Lenti ORF clone of Human MTOR associated protein, LST8 homolog (S. cerevisiae) (MLST8), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Rabbit Polyclonal Antibody against GBL (Center)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This GBL antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 140-170 amino acids from the Central region of human GBL. |
MLST8 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MLST8 |
Rabbit Polyclonal Anti-GBL Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GBL antibody: synthetic peptide directed towards the middle region of human GBL. Synthetic peptide located within the following region: CAFSGDSQYIVTASSDNLARLWCVETGEIKREYGGHQKAVVCLAFNDSVL |
USD 620.00
3 Weeks
Lenti ORF clone of Human MTOR associated protein, LST8 homolog (S. cerevisiae) (MLST8), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
MLST8 (untagged)-Human MTOR associated protein, LST8 homolog (S. cerevisiae) (MLST8), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal GBL Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | GbL antibody was raised against a 14 amino acid peptide from near the carboxy-terminus of human GbL. |
USD 121.00
In Stock
MLST8 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Anti-MLST8 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
USD 396.00
5 Days
Transient overexpression lysate of MTOR associated protein, LST8 homolog (S. cerevisiae) (MLST8)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
MLST8 (untagged) - Homo sapiens MTOR associated protein, LST8 homolog (S. cerevisiae) (MLST8), transcript variant 2
Vector | pCMV6 series |
Tag | Tag Free |
MLST8 (untagged) - Homo sapiens MTOR associated protein, LST8 homolog (S. cerevisiae) (MLST8), transcript variant 3
Vector | pCMV6 series |
Tag | Tag Free |
MLST8 (untagged) - Homo sapiens MTOR associated protein, LST8 homolog (S. cerevisiae) (MLST8), transcript variant 4
Vector | pCMV6 series |
Tag | Tag Free |
Transient overexpression of MLST8 (NM_022372) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MLST8 (NM_001199175) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MLST8 (NM_001199173) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MLST8 (NM_001199174) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MLST8 (NM_022372) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of MLST8 (NM_022372) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of MLST8 (NM_001199175) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of MLST8 (NM_001199173) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of MLST8 (NM_001199173) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of MLST8 (NM_001199174) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of MLST8 (NM_001199174) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack