Products

cDNA Clones (40)
Proteins (13)
RNAi (11)
Antibodies (10)
Gene Expression (6)
Jump to Filters
View as table Download
G protein beta subunit like (MLST8) (NM_022372) Human Tagged ORF Clone
RC210610

USD 420.00

In Stock

MLST8 (Myc-DDK-tagged)-Human MTOR associated protein, LST8 homolog (S. cerevisiae) (MLST8), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Mlst8 (NM_019988) Mouse Tagged ORF Clone
MR204763

USD 68.00

USD 149.00

In Stock

Mlst8 (Myc-DDK-tagged) - Mouse MTOR associated protein, LST8 homolog (S. cerevisiae) (Mlst8)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
G protein beta subunit like (MLST8) (NM_022372) Human Tagged ORF Clone Lentiviral Particle
RC210610L1V

USD 820.00

3 Weeks

Lenti ORF particles, MLST8 (Myc-DDK tagged) - Human MTOR associated protein, LST8 homolog (S. cerevisiae) (MLST8), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
G protein beta subunit like (MLST8) (NM_022372) Human Tagged ORF Clone Lentiviral Particle
RC210610L2V

USD 820.00

6 Weeks

Lenti ORF particles, MLST8 (mGFP-tagged) - Human MTOR associated protein, LST8 homolog (S. cerevisiae) (MLST8), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
Mlst8 (NM_001252463) Mouse Tagged ORF Clone
MR229256

USD 340.00

In Stock

Mlst8 (myc-DDK-tagged) - Mouse MTOR associated protein, LST8 homolog (S. cerevisiae) (Mlst8), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Mlst8 (NM_001252464) Mouse Tagged ORF Clone
MR229257

USD 340.00

In Stock

Mlst8 (myc-DDK-tagged) - Mouse MTOR associated protein, LST8 homolog (S. cerevisiae) (Mlst8), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
G protein beta subunit like (MLST8) (NM_001199173) Human Tagged ORF Clone
RC233768

USD 420.00

In Stock

MLST8 (Myc-DDK tagged) - Homo sapiens MTOR associated protein, LST8 homolog (S. cerevisiae) (MLST8), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
G protein beta subunit like (MLST8) (NM_001199174) Human Tagged ORF Clone
RC233769

USD 420.00

In Stock

MLST8 (Myc-DDK tagged) - Homo sapiens MTOR associated protein, LST8 homolog (S. cerevisiae) (MLST8), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
G protein beta subunit like (MLST8) (NM_022372) Human Tagged ORF Clone
RG210610

USD 460.00

In Stock

MLST8 (GFP-tagged) - Human MTOR associated protein, LST8 homolog (S. cerevisiae) (MLST8), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
G protein beta subunit like (MLST8) Human Gene Knockout Kit (CRISPR)
KN410610

USD 1,290.00

2 Weeks

MLST8 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN410610 is the updated version of KN210610.
Mlst8 (NM_019988) Mouse Tagged ORF Clone
MG204763

USD 300.00

3 Weeks

Mlst8 (GFP-tagged) - Mouse G protein beta subunit-like (Gbl)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Mlst8 (NM_019988) Mouse Tagged ORF Clone
MR204763L3

USD 500.00

3 Weeks

Lenti ORF clone of Mlst8 (Myc-DDK-tagged) - Mouse MTOR associated protein, LST8 homolog (S. cerevisiae) (Mlst8)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Mlst8 (NM_019988) Mouse Tagged ORF Clone Lentiviral Particle
MR204763L3V

USD 700.00

6 Weeks

Lenti ORF particles, Mlst8 (Myc-DDK-tagged) - Mouse MTOR associated protein, LST8 homolog (S. cerevisiae) (Mlst8), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Mlst8 (NM_019988) Mouse Tagged ORF Clone
MR204763L4

USD 500.00

3 Weeks

Lenti ORF clone of Mlst8 (mGFP-tagged) - Mouse MTOR associated protein, LST8 homolog (S. cerevisiae) (Mlst8)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Mlst8 (NM_019988) Mouse Tagged ORF Clone Lentiviral Particle
MR204763L4V

USD 700.00

6 Weeks

Lenti ORF particles, Mlst8 (GFP-tagged) - Mouse MTOR associated protein, LST8 homolog (S. cerevisiae) (Mlst8), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Mlst8 (NM_001252465) Mouse Tagged ORF Clone
MR228851

USD 270.00

2 Weeks

Mlst8 (myc-DDK-tagged) - Mouse MTOR associated protein, LST8 homolog (S. cerevisiae) (Mlst8), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
G protein beta subunit like (MLST8) (NM_022372) Human Tagged ORF Clone
RC210610L3

USD 620.00

3 Weeks

Lenti ORF clone of Human MTOR associated protein, LST8 homolog (S. cerevisiae) (MLST8), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
G protein beta subunit like (MLST8) (NM_022372) Human Tagged ORF Clone Lentiviral Particle
RC210610L3V

USD 820.00

5 Weeks

Lenti ORF particles, MLST8 (Myc-DDK tagged) - Human MTOR associated protein, LST8 homolog (S. cerevisiae) (MLST8), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
G protein beta subunit like (MLST8) (NM_022372) Human Tagged ORF Clone Lentiviral Particle
RC210610L4V

USD 820.00

7 Weeks

Lenti ORF particles, MLST8 (mGFP-tagged) - Human MTOR associated protein, LST8 homolog (S. cerevisiae) (MLST8), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
G protein beta subunit like (MLST8) (NM_001199175) Human Tagged ORF Clone
RC233765

USD 420.00

3 Weeks

MLST8 (Myc-DDK tagged) - Homo sapiens MTOR associated protein, LST8 homolog (S. cerevisiae) (MLST8), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
G protein beta subunit like (MLST8) (NM_001199175) Human Tagged ORF Clone
RG233765

USD 460.00

3 Weeks

MLST8 (GFP-tagged) - Homo sapiens MTOR associated protein, LST8 homolog (S. cerevisiae) (MLST8), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
G protein beta subunit like (MLST8) (NM_001199173) Human Tagged ORF Clone
RG233768

USD 460.00

3 Weeks

MLST8 (GFP-tagged) - Homo sapiens MTOR associated protein, LST8 homolog (S. cerevisiae) (MLST8), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
G protein beta subunit like (MLST8) (NM_001199174) Human Tagged ORF Clone
RG233769

USD 460.00

3 Weeks

MLST8 (GFP-tagged) - Homo sapiens MTOR associated protein, LST8 homolog (S. cerevisiae) (MLST8), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Mlst8 (NM_022404) Rat Tagged ORF Clone
RR203966

USD 420.00

4 Weeks

Mlst8 (Myc-DDK-tagged ORF) - Rat G protein beta subunit-like (Gbl), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Mlst8 (NM_022404) Rat Tagged ORF Clone
RR203966L3

USD 640.00

9 Weeks

Lenti ORF clone of Mlst8 (Myc-DDK-tagged ORF) - Rat G protein beta subunit-like (Gbl), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Mlst8 (NM_022404) Rat Tagged ORF Clone Lentiviral Particle
RR203966L3V

USD 850.00

13 Weeks

Lenti ORF particles, Mlst8 (Myc-DDK-tagged ORF) - Rat G protein beta subunit-like (Gbl), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Mlst8 (NM_022404) Rat Tagged ORF Clone
RR203966L4

USD 700.00

9 Weeks

Lenti ORF clone of Mlst8 (mGFP-tagged ORF) - Rat G protein beta subunit-like (Gbl), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Mlst8 (NM_022404) Rat Tagged ORF Clone Lentiviral Particle
RR203966L4V

USD 960.00

13 Weeks

Lenti ORF particles, Mlst8 (GFP-tagged ORF) - Rat G protein beta subunit-like (Gbl), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
G protein beta subunit like (MLST8) (NM_022372) Human Tagged ORF Clone
RC210610L1

USD 768.00

In Stock

Lenti ORF clone of Human MTOR associated protein, LST8 homolog (S. cerevisiae) (MLST8), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
G protein beta subunit like (MLST8) Rabbit Polyclonal Antibody
TA302160

USD 450.00

In Stock

Rabbit Polyclonal Antibody against GBL (Center)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This GBL antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 140-170 amino acids from the Central region of human GBL.
G protein beta subunit like (MLST8) Rabbit Polyclonal Antibody
TA326904

USD 374.00

3 Weeks

MLST8 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human MLST8
G protein beta subunit like (MLST8) Rabbit Polyclonal Antibody
TA344683

USD 475.00

5 Days

Rabbit Polyclonal Anti-GBL Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GBL antibody: synthetic peptide directed towards the middle region of human GBL. Synthetic peptide located within the following region: CAFSGDSQYIVTASSDNLARLWCVETGEIKREYGGHQKAVVCLAFNDSVL
G protein beta subunit like (MLST8) Rabbit Polyclonal Antibody
TA372590

USD 380.00

4 Weeks

MLST8 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human MLST8
G protein beta subunit like (MLST8) (NM_022372) Human Tagged ORF Clone
RC210610L2

USD 620.00

3 Weeks

Lenti ORF clone of Human MTOR associated protein, LST8 homolog (S. cerevisiae) (MLST8), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
G protein beta subunit like (MLST8) (NM_022372) Human Untagged Clone
SC127163

USD 310.00

In Stock

MLST8 (untagged)-Human MTOR associated protein, LST8 homolog (S. cerevisiae) (MLST8), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
G protein beta subunit like (MLST8) Rabbit Polyclonal Antibody
TA306214

USD 430.00

5 Days

Rabbit Polyclonal GBL Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen GbL antibody was raised against a 14 amino acid peptide from near the carboxy-terminus of human GbL.
G protein beta subunit like (MLST8) Rabbit Polyclonal Antibody
TA324118

USD 345.00

4 Weeks

Anti-MLST8 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
G protein beta subunit like (MLST8) (NM_022372) Human Over-expression Lysate
LY411693

USD 396.00

5 Days

Transient overexpression lysate of MTOR associated protein, LST8 homolog (S. cerevisiae) (MLST8)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Human G protein beta subunit like (MLST8) activation kit by CRISPRa
GA112021

USD 1,290.00

2 Weeks

MLST8 CRISPRa kit - CRISPR gene activation of human MTOR associated protein, LST8 homolog

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Mlst8 activation kit by CRISPRa
GA206066

USD 1,290.00

2 Weeks

Mlst8 CRISPRa kit - CRISPR gene activation of mouse MTOR associated protein, LST8 homolog (S. cerevisiae)

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
MLST8 Human qPCR Template Standard (NM_022372)
HK203288

USD 330.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene GBL

Application Plasmid of exact quantity for transcript copy number calculation
Mlst8 (NM_019988) Mouse Untagged Clone
MC207533

USD 420.00

3 Weeks

Mlst8 (untagged) - Mouse MTOR associated protein, LST8 homolog (S. cerevisiae) (Mlst8), (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Mlst8 (NM_001252465) Mouse Untagged Clone
MC226640

USD 270.00

2 Weeks

Mlst8 (untagged) - Mouse MTOR associated protein, LST8 homolog (S. cerevisiae) (Mlst8), transcript variant 4

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Mlst8 (NM_001252463) Mouse Untagged Clone
MC227045

USD 330.00

2 Weeks

Mlst8 (untagged) - Mouse MTOR associated protein, LST8 homolog (S. cerevisiae) (Mlst8), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Mlst8 (NM_001252464) Mouse Untagged Clone
MC227046

USD 330.00

2 Weeks

Mlst8 (untagged) - Mouse MTOR associated protein, LST8 homolog (S. cerevisiae) (Mlst8), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Mlst8 Mouse qPCR Primer Pair (NM_019988)
MP205069

USD 120.00

5 Days

qSTAR qPCR primer pairs against Mus musculus gene Mlst8

Mlst8 (NM_022404) Rat Untagged Clone
RN203966

USD 420.00

5 Weeks

Mlst8 (untagged ORF) - Rat G protein beta subunit-like (Gbl), (10 ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin